PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.013G251200.4
Common NameB456_013G251200, LOC105783148
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NF-YA
Protein Properties Length: 174aa    MW: 18968.3 Da    PI: 10.6928
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.013G251200.4genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA104.97.2e-333187158
           CBFB_NFYA  1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
                        +ep+YVNaKQyq+Il+RRq+Rak+e ekk+  ksrkpylheSRh+hAlrR+RgsgGrF
  Gorai.013G251200.4 31 QEPVYVNAKQYQGILRRRQARAKAELEKKV-VKSRKPYLHESRHQHALRRARGSGGRF 87
                        69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.8E-352990IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.9493090IPR001289Nuclear transcription factor Y subunit A
PfamPF020454.4E-293287IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.2E-243355IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS0068603555IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.2E-246487IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010262Biological Processsomatic embryogenesis
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0055046Biological Processmicrogametogenesis
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 174 aa     Download sequence    Send to blast
MMAAYGHQPM GYPPFVGMPH ARMTLPIEMA QEPVYVNAKQ YQGILRRRQA RAKAELEKKV  60
VKSRKPYLHE SRHQHALRRA RGSGGRFAKK TDTNPGEEKG SGSGPTLSSQ SPSSSGSEPL  120
QTDSNETWTS SLTQHAIHHV NGGSHYQKLG GNISNQAAFY PVNGGQSFQK LKG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A7e-203187258NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:11250072, ECO:0000269|PubMed:9662544}.
Functional Description ? help Back to Top
Source Description
UniProtStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150382e-36AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012463850.11e-125PREDICTED: nuclear transcription factor Y subunit A-1 isoform X1
RefseqXP_012463851.11e-125PREDICTED: nuclear transcription factor Y subunit A-1 isoform X2
RefseqXP_012463853.11e-125PREDICTED: nuclear transcription factor Y subunit A-1 isoform X2
RefseqXP_012463854.11e-126PREDICTED: nuclear transcription factor Y subunit A-1 isoform X3
RefseqXP_012463855.11e-126PREDICTED: nuclear transcription factor Y subunit A-1 isoform X3
RefseqXP_012463856.11e-126PREDICTED: nuclear transcription factor Y subunit A-1 isoform X3
SwissprotQ9LXV52e-53NFYA1_ARATH; Nuclear transcription factor Y subunit A-1
TrEMBLA0A0D2SI751e-124A0A0D2SI75_GOSRA; Uncharacterized protein
TrEMBLA0A0D2U5901e-123A0A0D2U590_GOSRA; Uncharacterized protein
TrEMBLA0A0D2VIR21e-125A0A0D2VIR2_GOSRA; Uncharacterized protein
STRINGGorai.013G251200.11e-124(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20910.12e-51nuclear factor Y, subunit A9
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Siriwardana CL, et al.
    NUCLEAR FACTOR Y, Subunit A (NF-YA) Proteins Positively Regulate Flowering and Act Through FLOWERING LOCUS T.
    PLoS Genet., 2016. 12(12): p. e1006496
    [PMID:27977687]
  4. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]