PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.013G251200.1
Common NameB456_013G251200, LOC105783148
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NF-YA
Protein Properties Length: 316aa    MW: 33764.1 Da    PI: 7.4981
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.013G251200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA103.42.1e-32173229158
           CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                         +ep+YVNaKQyq+Il+RRq+Rak+e ekk+  ksrkpylheSRh+hAlrR+RgsgGrF
  Gorai.013G251200.1 173 QEPVYVNAKQYQGILRRRQARAKAELEKKV-VKSRKPYLHESRHQHALRRARGSGGRF 229
                         69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.8E-35171232IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.949172232IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.3E-28174229IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006167.1E-24175197IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860177197IPR018362CCAAT-binding factor, conserved site
PRINTSPR006167.1E-24206229IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010262Biological Processsomatic embryogenesis
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0055046Biological Processmicrogametogenesis
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MQSNSEEGSQ LEPDVHGVHP TAVYSEPKWC NTGYGAISSG ARGVNSLNSS SMECTNASES  60
NDGQSLSNGA LNEEDDVNKE TQTTASSRAV GTGGQEHHNL QHVGSSMPAV RDEGLTQPPL  120
LELVGHSIAC ASNPYIDPLY GGMMAAYGHQ PMGYPPFVGM PHARMTLPIE MAQEPVYVNA  180
KQYQGILRRR QARAKAELEK KVVKSRKPYL HESRHQHALR RARGSGGRFA KKTDTNPGEE  240
KGSGSGPTLS SQSPSSSGSE PLQTDSNETW TSSLTQHAIH HVNGGSHYQK LGGNISNQAA  300
FYPVNGGQSF QKLKG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A6e-19173229258NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:11250072, ECO:0000269|PubMed:9662544}.
Functional Description ? help Back to Top
Source Description
UniProtStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150384e-36AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012463850.10.0PREDICTED: nuclear transcription factor Y subunit A-1 isoform X1
SwissprotQ9LXV57e-86NFYA1_ARATH; Nuclear transcription factor Y subunit A-1
TrEMBLA0A0D2U5900.0A0A0D2U590_GOSRA; Uncharacterized protein
STRINGGorai.013G251200.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM59462646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12840.34e-82nuclear factor Y, subunit A1
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Siriwardana CL, et al.
    NUCLEAR FACTOR Y, Subunit A (NF-YA) Proteins Positively Regulate Flowering and Act Through FLOWERING LOCUS T.
    PLoS Genet., 2016. 12(12): p. e1006496
    [PMID:27977687]
  4. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]