PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.013G226200.1
Common NameB456_013G226200, LOC105783980
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NF-YA
Protein Properties Length: 323aa    MW: 35950 Da    PI: 7.6298
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.013G226200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA1032.8e-32185241158
           CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                         dep+YVN+KQy++Il+RRq Rakle+++kl  ksrkpylheSRh+hAl+R RgsgGrF
  Gorai.013G226200.1 185 DEPIYVNPKQYHGILRRRQYRAKLEAQNKL-VKSRKPYLHESRHRHALNRVRGSGGRF 241
                         79****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.7E-36183244IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.017184244IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.0E-27186241IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.3E-23187209IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.3E-23218241IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MAVRVQNFPK KTFDESSVRS LSHLSVSCTP WWSLNEQQIE EPLPHNVSLK VETPSQLYHQ  60
TKHLDLQLPD QELTTVQAIG RTHCEVGAIG ATSSQCDPSE SGPDESCEKD TEGQVKPVFL  120
VNNPNTLFSP SHENYNHSMA WTQYPYANAY FNGMFTPYGP QAIIQAQLGG NAPTRIPLPL  180
DLAEDEPIYV NPKQYHGILR RRQYRAKLEA QNKLVKSRKP YLHESRHRHA LNRVRGSGGR  240
FLSKKTLQQP NDNCTNRTNS RSELESHCSR MAGYGGPNTS CMNISSVSDN DGNLQWLEHG  300
FADISRAGST GDGIRHGASV IP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A3e-21185251268NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012465162.10.0PREDICTED: nuclear transcription factor Y subunit A-4-like isoform X2
RefseqXP_012465163.10.0PREDICTED: nuclear transcription factor Y subunit A-4-like isoform X2
TrEMBLA0A0D2VJ230.0A0A0D2VJ23_GOSRA; Uncharacterized protein
STRINGGorai.013G226200.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1809668
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.11e-42nuclear factor Y, subunit A3
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]