PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.013G210600.1
Common NameB456_013G210600, LOC105784177
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family M-type_MADS
Protein Properties Length: 164aa    MW: 18815 Da    PI: 10.6348
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.013G210600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF31.81.9e-101150342
                        --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
              SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                        i n+s r++t+ +R + + KK  EL +LC++e   ++ s+
  Gorai.013G210600.1 11 ITNDSARKTTYKRRTKCLVKKVRELTTLCGIEGFAVMNSP 50
                        89*****************************987777776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006613.54149IPR002100Transcription factor, MADS-box
SMARTSM004324.1E-12161IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.06E-18395IPR002100Transcription factor, MADS-box
CDDcd002661.01E-17386No hitNo description
PfamPF003193.9E-111151IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MSRKKIKLAY ITNDSARKTT YKRRTKCLVK KVRELTTLCG IEGFAVMNSP DFGSQVEVWP  60
SLEDARRLLS DFKKLPLSKQ NKKMVSQESF LEQSLAKATQ QLRKLREKNR QKELKEVMFE  120
SLSGKGILQS LNAMDLDEVD LLVKQNLTDI DYRVRVLTKA SRS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2431011e-77AC243101.1 Gossypium arboreum clone GM203N05-jhe, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012465435.11e-115PREDICTED: agamous-like MADS-box protein AGL80
TrEMBLA0A0D2W8321e-114A0A0D2W832_GOSRA; Uncharacterized protein
STRINGGorai.013G210600.11e-114(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.12e-44AGAMOUS-like 80
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]