PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.013G191800.1
Common NameB456_013G191800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 167aa    MW: 19071.8 Da    PI: 10.3068
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.013G191800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.79.3e-5381421128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrFhPtdeel+ +yL kk++++++++ ++i++vdiyk++PwdLp k+  +ekewyfFs+rd+ky++g r+nra+ sgyWkatg+dk 
  Gorai.013G191800.1   8 LPPGFRFHPTDEELILHYLMKKLSSSPFPV-SIIADVDIYKFDPWDLPDKAVFGEKEWYFFSPRDRKYPNGARPNRAAGSGYWKATGTDKI 97 
                         79****************************.89***************7777899************************************ PP

                 NAM  92 vlsk..kgel........vglkktLvfykgrapkgektdWvmheyrl 128
                         ++++     +        +g+kk Lvfykgr pkg kt+W+mheyrl
  Gorai.013G191800.1  98 IVASsmA--AgrggvfsnIGVKKALVFYKGRPPKGIKTNWIMHEYRL 142
                         **97550..355566778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.02E-604149IPR003441NAC domain
PROSITE profilePS5100555.8228167IPR003441NAC domain
PfamPF023651.1E-279142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 167 aa     Download sequence    Send to blast
MRLPHSSLPP GFRFHPTDEE LILHYLMKKL SSSPFPVSII ADVDIYKFDP WDLPDKAVFG  60
EKEWYFFSPR DRKYPNGARP NRAAGSGYWK ATGTDKIIVA SSMAAGRGGV FSNIGVKKAL  120
VFYKGRPPKG IKTNWIMHEY RLSQNPNPNS NNRSFKSKDC SMRLDDW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-67316712157NO APICAL MERISTEM PROTEIN
1ut4_B3e-67316712157NO APICAL MERISTEM PROTEIN
1ut7_A3e-67316712157NO APICAL MERISTEM PROTEIN
1ut7_B3e-67316712157NO APICAL MERISTEM PROTEIN
3swm_A3e-67316715160NAC domain-containing protein 19
3swm_B3e-67316715160NAC domain-containing protein 19
3swm_C3e-67316715160NAC domain-containing protein 19
3swm_D3e-67316715160NAC domain-containing protein 19
3swp_A3e-67316715160NAC domain-containing protein 19
3swp_B3e-67316715160NAC domain-containing protein 19
3swp_C3e-67316715160NAC domain-containing protein 19
3swp_D3e-67316715160NAC domain-containing protein 19
4dul_A3e-67316712157NAC domain-containing protein 19
4dul_B3e-67316712157NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gra.12810.0flower| flowering
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO488112760.0
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the promoter of ACO5, an ACC oxidase involved in ethylene biosynthesis. Mediates waterlogging-induced hyponastic leaf movement, and cell expansion in abaxial cells of the basal petiole region, by directly regulating the expression of ACO5 (PubMed:24363315). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000269|PubMed:24363315}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By root flooding (PubMed:24363315). Induced by senescence (PubMed:24659488). {ECO:0000269|PubMed:24363315, ECO:0000269|PubMed:24659488}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012463494.11e-122PREDICTED: NAC domain-containing protein 18-like, partial
SwissprotQ84TD61e-81NAC47_ARATH; NAC transcription factor 47
TrEMBLA0A2P5QWE51e-121A0A2P5QWE5_GOSBA; Uncharacterized protein
STRINGGorai.013G191800.11e-121(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19028276
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04070.16e-82NAC domain containing protein 47
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  2. Hofmann NR
    A NAC transcription factor for flooding: SHYG helps plants keep their leaves in the air.
    Plant Cell, 2013. 25(12): p. 4771
    [PMID:24363314]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]