PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.013G155200.1
Common NameB456_013G155200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family M-type_MADS
Protein Properties Length: 206aa    MW: 22865.8 Da    PI: 10.0606
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.013G155200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF29.69e-101151343
                        --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
              SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                        i n+s r+vt+ kR + +  K + LS+ C+ + +vi++s+ 
  Gorai.013G155200.1 11 ITNDSTRKVTYKKRMKALKNKMSKLSTRCGSDTCVIMYSPY 51
                        89*************************************84 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006613.035149IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.7E-15164IPR002100Transcription factor, MADS-box
SMARTSM004324.6E-11160IPR002100Transcription factor, MADS-box
CDDcd002661.03E-21267No hitNo description
PfamPF104914.2E-5354IPR019525Nuclear respiratory factor 1, NLS/DNA-binding, dimerisation domain
PfamPF003195.2E-121151IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MTRKKVKLAY ITNDSTRKVT YKKRMKALKN KMSKLSTRCG SDTCVIMYSP YKSQLEVWPS  60
PMKEKEITQV VINNICGKGA VHGLNSGALS DISLLLDKKM SNIDKKIDAL SKTPLNLQGL  120
SPLPSSSVVA LPLMTMVTPK AMLRTGTENI VQPDVNNMDP MQRQQWIMDL VCNNNNNPQT  180
HVGGDEMMFQ FGDNIKLNNG LCLFP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1225RKKVKLAYITNDSTRKVTYKKRMK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016729029.13e-89PREDICTED: agamous-like MADS-box protein AGL80
TrEMBLA0A0D2VE971e-149A0A0D2VE97_GOSRA; Uncharacterized protein
STRINGGorai.013G155200.11e-150(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G05860.22e-18M-type_MADS family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]