PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.013G146300.1
Common NameB456_013G146300, LOC105784273
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 318aa    MW: 36080.3 Da    PI: 5.0132
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.013G146300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.15.8e-5661331128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                         lppGfrFhPtdeelv +yL +k++g+++el e+i+evd+yk+ePwdLp k  + +++ ewyf+s+rdkky++g+r+nrat+ gyWkatgkd
  Gorai.013G146300.1   6 LPPGFRFHPTDEELVAYYLDRKISGRTIEL-EIIPEVDLYKCEPWDLPdKsFLPSKDMEWYFYSPRDKKYPNGSRTNRATRGGYWKATGKD 95 
                         79****************************.99**************96435566888********************************* PP

                 NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++v + ++++vg+kktLv+y+grap+g +t+Wvmheyrl
  Gorai.013G146300.1  96 RAVQT-SKAVVGMKKTLVYYRGRAPHGIRTNWVMHEYRL 133
                         ****9.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.4E-643157IPR003441NAC domain
PROSITE profilePS5100560.7376157IPR003441NAC domain
PfamPF023653.7E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MAPMTLPPGF RFHPTDEELV AYYLDRKISG RTIELEIIPE VDLYKCEPWD LPDKSFLPSK  60
DMEWYFYSPR DKKYPNGSRT NRATRGGYWK ATGKDRAVQT SKAVVGMKKT LVYYRGRAPH  120
GIRTNWVMHE YRLLHSASPT APSSLKDSYS LCRIFKKNIQ IPKTKEAPVD NNQSFGDEIS  180
RGREAEVEDE NFNTSSSDVT QGTPNETGVA DEYQPPFTSD EANSSANLSS LGPDFSSHPF  240
QIPSYTNLHY QAPYPPLELE DFPQINIISE TKASKAEIID EYMMYDKCKD YMNGSLEEIF  300
SLCASQDNSM PPLSMHD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-58115812166NO APICAL MERISTEM PROTEIN
1ut4_B5e-58115812166NO APICAL MERISTEM PROTEIN
1ut7_A5e-58115812166NO APICAL MERISTEM PROTEIN
1ut7_B5e-58115812166NO APICAL MERISTEM PROTEIN
4dul_A5e-58115812166NAC domain-containing protein 19
4dul_B5e-58115812166NAC domain-containing protein 19
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in a few sieve element cells before enucleation and in phloem-pole pericycle cells. {ECO:0000269|PubMed:25081480}.
UniprotTISSUE SPECIFICITY: Expressed in a few sieve element cells before enucleation and in phloem-pole pericycle cells. {ECO:0000269|PubMed:25081480}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC045, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}.
UniProtTranscription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC086, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00205DAPTransfer from AT1G54330Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Regulated by the transcription factor APL (AC Q9SAK5). {ECO:0000269|PubMed:25081480}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC8471980.0KC847198.1 Gossypium hirsutum NAC domain protein NAC21 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001313743.10.0NAC domain-containing protein 86-like
RefseqXP_012465563.10.0PREDICTED: NAC domain-containing protein 86-like
SwissprotA4VCM06e-86NAC45_ARATH; NAC domain-containing protein 45
SwissprotQ9FFI57e-86NAC86_ARATH; NAC domain-containing protein 86
TrEMBLA0A0D2U1F60.0A0A0D2U1F6_GOSRA; Uncharacterized protein
TrEMBLW6JEX90.0W6JEX9_GOSHI; NAC domain protein NAC21
STRINGGorai.013G146300.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM81232640
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54330.11e-112NAC domain containing protein 20
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]