PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.013G140700.2
Common NameB456_013G140700, LOC105781137
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 315aa    MW: 36414.6 Da    PI: 6.1327
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.013G140700.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.61.1e-5381361128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                         +ppGfrFhPt+eelv +yL++k+++ k++l +vi e+d+yk+ePwd+++  +v + e++ewyfFs +d+ky+tg+r+nrat++g+Wkatg+
  Gorai.013G140700.2   8 VPPGFRFHPTEEELVGYYLRRKINSLKIDL-DVIIEIDLYKMEPWDIQArcNVGNeEQSEWYFFSYKDRKYPTGTRTNRATAAGFWKATGR 97 
                         69****************************.99**************953433332555******************************** PP

                 NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         dk+vls k++ +g++ktLvfykgrap+g+ktdW+mheyrl
  Gorai.013G140700.2  98 DKSVLS-KNNIIGMRKTLVFYKGRAPNGRKTDWIMHEYRL 136
                         ******.8899***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.24E-596157IPR003441NAC domain
PROSITE profilePS5100558.2168157IPR003441NAC domain
PfamPF023653.3E-289136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009735Biological Processresponse to cytokinin
GO:0009737Biological Processresponse to abscisic acid
GO:0009741Biological Processresponse to brassinosteroid
GO:0045491Biological Processxylan metabolic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048759Biological Processxylem vessel member cell differentiation
GO:0050832Biological Processdefense response to fungus
GO:0071365Biological Processcellular response to auxin stimulus
GO:0090059Biological Processprotoxylem development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MMELESCVPP GFRFHPTEEE LVGYYLRRKI NSLKIDLDVI IEIDLYKMEP WDIQARCNVG  60
NEEQSEWYFF SYKDRKYPTG TRTNRATAAG FWKATGRDKS VLSKNNIIGM RKTLVFYKGR  120
APNGRKTDWI MHEYRLQTSE HGPPQEEGWV VCRAFRKPCP NQRQGFEAWS HGYYMRDNSQ  180
VRPPVSLSDI ATTSHLHLRR NQGSSFYESY GSEQELVSNS HNFLDSQQVI ELPQLDSPIT  240
VSPSLAEKEV FHCDEEKSNE SSQIHIIDWK NFDNLFNSQL TDTTSYPYQT AALIPQNDEL  300
EAQQHHLLGC FPGS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-49315710168Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Predominantly expressed in immature xylem vessels, only in some cells just beside xylem vessels. Also present in various vascular cells of older part of the roots, near the location of emergence of the lateral roots. {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:18445131}.
UniprotTISSUE SPECIFICITY: Expressed in developing protoxylems in roots and shoots (PubMed:16103214, PubMed:16581911, PubMed:17565617, PubMed:18952777). Detected in root protoxylem poles and in vessels of protoxylems, outermost metaxylems, inner metaxylems, shoots and hypocotyls. Expressed in roots, hypocotyls, cotyledons and leaves (PubMed:18445131). Accumulates in the xylem but not in interfascicular fibers or pith cells in inflorescence stems. Present in developing vessels of the secondary xylem in roots undergoing secondary growth (PubMed:18952777). {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:16581911, ECO:0000269|PubMed:17565617, ECO:0000269|PubMed:18445131, ECO:0000269|PubMed:18952777}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (e.g. genes involved in secondary wall biosynthesis, cell wall modification such as xylan accumulation, and programmed cell death) (PubMed:20935069, PubMed:20488898, PubMed:22037706, PubMed:21284754). Involved in xylem formation in roots and shoots, especially regulating protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:16103214, PubMed:18445131, PubMed:20488898, PubMed:21498679, PubMed:21284754). Can activate the expression of several genes including XCP1, MYB46, NAC010/SND3, MYB103, MYB58, MYB63, MYB83, KNAT7, ASL19 and ASL20 (PubMed:17890373, PubMed:19088331, PubMed:18952777, PubMed:19122102, PubMed:19808805, PubMed:20935069, PubMed:21284754). {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:17890373, ECO:0000269|PubMed:18445131, ECO:0000269|PubMed:18952777, ECO:0000269|PubMed:19088331, ECO:0000269|PubMed:19122102, ECO:0000269|PubMed:19808805, ECO:0000269|PubMed:20488898, ECO:0000269|PubMed:20935069, ECO:0000269|PubMed:21284754, ECO:0000269|PubMed:21498679, ECO:0000269|PubMed:22037706}.; FUNCTION: Required for the soilborne fungal pathogen Verticillium longisporum-induced transdifferentiation of chloroplast-containing bundle sheath cells to functional xylem elements leading to stunted growth, vein clearing, and leaf chloroses, as well as xylem hyperplasia within the vasculature of leaves, hypocotyls, and roots due to reinitiation of cambial activity and transdifferentiation of xylem parenchyma cells. This developmental reprogramming mediates also an increased drought stress tolerance. {ECO:0000269|PubMed:23023171}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00017PBMTransfer from AT1G71930Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By brassinosteroids (e.g. brassinolide BL), auxin (e.g. 2,4-dichlorphenoxyacetic acid 2,4-D) and cytokinin (e.g. kinetin), with a synergistic effect (PubMed:16103214, PubMed:22345435). Up-regulated in a feed-back loop by ASL20 (PubMed:19088331). Levels are monitored by proteasome-mediated degradation (PubMed:18445131). Repressed by WEE1 upon replication stress to prevent premature tracheary element differentiation (PubMed:21498679). Accumulates during infection by the soilborne fungal pathogen Verticillium longisporum, especially in tissues undergoing de novo xylem formation (PubMed:23023171). {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:18445131, ECO:0000269|PubMed:19088331, ECO:0000269|PubMed:21498679, ECO:0000269|PubMed:22345435, ECO:0000269|PubMed:23023171}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012461159.10.0PREDICTED: NAC domain-containing protein 43
RefseqXP_012461160.10.0PREDICTED: NAC domain-containing protein 43
SwissprotQ9C8W91e-120NAC30_ARATH; NAC domain-containing protein 30
TrEMBLA0A0D2U1740.0A0A0D2U174_GOSRA; Uncharacterized protein
STRINGGorai.013G140700.10.0(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71930.11e-111vascular related NAC-domain protein 7
Publications ? help Back to Top
  1. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]
  2. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  3. Kakehi J, et al.
    Mutations in ribosomal proteins, RPL4 and RACK1, suppress the phenotype of a thermospermine-deficient mutant of Arabidopsis thaliana.
    PLoS ONE, 2015. 10(1): p. e0117309
    [PMID:25625317]
  4. Li Z, et al.
    A Transcriptional and Metabolic Framework for Secondary Wall Formation in Arabidopsis.
    Plant Physiol., 2016. 172(2): p. 1334-1351
    [PMID:27566165]
  5. de Lucas M, et al.
    Transcriptional Regulation of Arabidopsis Polycomb Repressive Complex 2 Coordinates Cell-Type Proliferation and Differentiation.
    Plant Cell, 2016. 28(10): p. 2616-2631
    [PMID:27650334]
  6. Tan TT, et al.
    Transcription Factors VND1-VND3 Contribute to Cotyledon Xylem Vessel Formation.
    Plant Physiol., 2018. 176(1): p. 773-789
    [PMID:29133368]
  7. Ohashi-Ito K,Iwamoto K,Fukuda H
    LOB DOMAIN-CONTAINING PROTEIN 15 Positively Regulates Expression of VND7, a Master Regulator of Tracheary Elements.
    Plant Cell Physiol., 2018. 59(5): p. 989-996
    [PMID:29444288]