PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.013G118000.2
Common NameB456_013G118000, LOC105784245
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 261aa    MW: 29319.9 Da    PI: 6.6655
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.013G118000.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM110.81.5e-3427754129
                 NAM  54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                         +ekewyfF++rd+ky+tg r+nrat++gyWkatgkdke+++ kg lvg+kktLvfykgrap+gekt+Wvmheyrle
  Gorai.013G118000.2   2 GEKEWYFFCQRDRKYPTGMRTNRATQAGYWKATGKDKEIFKGKGCLVGMKKTLVFYKGRAPRGEKTNWVMHEYRLE 77 
                         579**************************************9********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100542.2641101IPR003441NAC domain
SuperFamilySSF1019417.59E-392102IPR003441NAC domain
PfamPF023657.8E-17676IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MGEKEWYFFC QRDRKYPTGM RTNRATQAGY WKATGKDKEI FKGKGCLVGM KKTLVFYKGR  60
APRGEKTNWV MHEYRLEGKF SYYNLPKAAK DEWVVCRVFH KNTAGINKSP IAMASLGDEF  120
MDYASLPPLM DPTFDCESEF KAINKTPVSS SIFNPQIPTQ DPVFFHPETS DSGTGSLRTE  180
DEASIRALAG NYSGDHIGQR QCNKVEQFSS NQSMVSPSQD TGHSTEINNN EISSVISKSF  240
GLGSIDPYDD IEDLACLWNY *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-32110568169NO APICAL MERISTEM PROTEIN
1ut4_B8e-32110568169NO APICAL MERISTEM PROTEIN
1ut7_A8e-32110568169NO APICAL MERISTEM PROTEIN
1ut7_B8e-32110568169NO APICAL MERISTEM PROTEIN
3swm_A9e-32110571172NAC domain-containing protein 19
3swm_B9e-32110571172NAC domain-containing protein 19
3swm_C9e-32110571172NAC domain-containing protein 19
3swm_D9e-32110571172NAC domain-containing protein 19
3swp_A9e-32110571172NAC domain-containing protein 19
3swp_B9e-32110571172NAC domain-containing protein 19
3swp_C9e-32110571172NAC domain-containing protein 19
3swp_D9e-32110571172NAC domain-containing protein 19
4dul_A8e-32110568169NAC domain-containing protein 19
4dul_B8e-32110568169NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU7063400.0EU706340.1 Gossypium hirsutum NAC domain protein NAC6 (NAC6) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012465518.10.0PREDICTED: NAC domain-containing protein 100
SwissprotQ9FK441e-80NAC87_ARATH; NAC domain-containing protein 87
TrEMBLA0A0D2TZN70.0A0A0D2TZN7_GOSRA; Uncharacterized protein
TrEMBLA0A0D2VDX90.0A0A0D2VDX9_GOSRA; Uncharacterized protein
TrEMBLA0A1U8I8590.0A0A1U8I859_GOSHI; NAC domain-containing protein 92-like
TrEMBLA0A2P5QPY60.0A0A2P5QPY6_GOSBA; Uncharacterized protein
STRINGGorai.013G118000.10.0(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.25e-83Arabidopsis NAC domain containing protein 87
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]