PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.013G071300.5
Common NameB456_013G071300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family CO-like
Protein Properties Length: 415aa    MW: 45233.1 Da    PI: 6.465
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.013G071300.5genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box16.71.6e-05234335
            zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHk 35
                        e++C+ +  +++  +C++++  lC +C    H+
  Gorai.013G071300.5  2 EPVCDFCRGERAVVYCKSDSARLCLSCDGCVHS 34
                        689************************998885 PP

2CCT591.6e-20358401144
                 CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                         R++a+ RY+eK+ktR F K+irY+sRKa+A++R+RvKGrFvk+ 
  Gorai.013G071300.5 358 RDKAKIRYNEKKKTRIFGKQIRYASRKARADTRKRVKGRFVKAG 401
                         888999***********************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003367.2E-7147IPR000315B-box-type zinc finger
PROSITE profilePS501199.286133IPR000315B-box-type zinc finger
CDDcd000214.20E-5347No hitNo description
PfamPF062035.2E-16358400IPR010402CCT domain
PROSITE profilePS5101714.426358400IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 415 aa     Download sequence    Send to blast
MEPVCDFCRG ERAVVYCKSD SARLCLSCDG CVHSANLLSC RHVRSLLCEK CNSQSAVVRC  60
LDEKLSLCQD CDGNGNGCSS LGHWREALNS YTDCPSLAEF RRIWSSVLGA SSPAVFDVDW  120
PVGASTANDN CFTNCLNQID LGGSFELAGT KLNELDSCPK LKPCMVSSSL ISPNANYIPY  180
SKDGEPVFSE EPNMPKGFSD LRDFKVPDGD DLCEGLNIND VQFSFKTANE IFGGSQGQTR  240
YQFEKVGTDG LIMDKTLPAL PSGQKECLSF PSSQVGCSAS IMATMIGTSN CMLMNPSCNQ  300
NINLGYPVGQ VPSNLAPSPS NITVKNSPAD FQDCGLPPAF LTGDSHFQNL EASCPQARDK  360
AKIRYNEKKK TRIFGKQIRY ASRKARADTR KRVKGRFVKA GEEYDYDPLV ARNF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5780789e-41JX578078.1 Gossypium hirsutum clone NBRI_GE10025 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012465555.10.0PREDICTED: putative zinc finger protein CONSTANS-LIKE 11
TrEMBLA0A0D2VBU20.0A0A0D2VBU2_G
STRINGGLYMA13G38251.11e-150(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G21880.11e-90B-box type zinc finger protein with CCT domain
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]