PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.013G068600.1
Common NameB456_013G068600, LOC105782793
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family TCP
Protein Properties Length: 257aa    MW: 26423.6 Da    PI: 10.3339
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.013G068600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP123.32.8e-3828113288
                 TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssg 88 
                         a+kk +++++h+kv+gR+RR+R+++ caar+F+L++eLG+++d++tieWLl+qa+p+i+++tgt++++as++ ++s s+ ++++s +
  Gorai.013G068600.1  28 AVKKPPSKDRHSKVDGRGRRIRMPIICAARVFQLTRELGHKSDGQTIEWLLRQAEPSIIAATGTGTTPASFS-TVSVSVRGGANSTS 113
                         78*******************************************************************777.34444444433333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036342.6E-3334123IPR005333Transcription factor, TCP
PROSITE profilePS5136928.2093488IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MSNSEAAAKN GATMDTQRQQ APGNGALAVK KPPSKDRHSK VDGRGRRIRM PIICAARVFQ  60
LTRELGHKSD GQTIEWLLRQ AEPSIIAATG TGTTPASFST VSVSVRGGAN STSLPSTTSS  120
SLDHKPLLGS TPFLLGKRVR PDDDNAGKDD SGGATVGPGV GSIVGPAGTH TGAFWAVPAR  180
PDFGQIWSFA PPPPPEMVVQ TAAQQPAAAA FFVQQQQAMG EASAARVGNY LPGHLNLLAS  240
LSGAPGGSGQ RDDDPR*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00524DAPTransfer from AT5G23280Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012463239.10.0PREDICTED: transcription factor TCP21
SwissprotQ9FMX21e-94TCP7_ARATH; Transcription factor TCP7
TrEMBLA0A0D2VBM40.0A0A0D2VBM4_GOSRA; Uncharacterized protein
TrEMBLA0A2P5Y7A70.0A0A2P5Y7A7_GOSBA; Uncharacterized protein
STRINGGorai.013G068600.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17822685
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23280.11e-68TCP family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]