PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.013G044500.4
Common NameB456_013G044500, LOC105782227
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 409aa    MW: 44277.7 Da    PI: 9.4029
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.013G044500.4genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_142.81.1e-13330381556
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                         +r+rr++kNRe+A rsR+RK+a++ eLe +v +L++ N++L  + ee  ++ 
  Gorai.013G044500.4 330 RRQRRMIKNRESAARSRARKQAYTLELEAEVSKLKEMNEELLRKQEEVMEMQ 381
                         79************************************99988888877765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.7E-12326392IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.645328379IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.8E-13330380No hitNo description
SuperFamilySSF579593.59E-10330379No hitNo description
PfamPF001704.7E-12330382IPR004827Basic-leucine zipper domain
CDDcd147075.24E-25330384No hitNo description
PROSITE patternPS000360333348IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 409 aa     Download sequence    Send to blast
MGSNLNFKRF GEAPSMEGNG SKAVGNFPLA RQSSIYSLTF DELQNTFGGL GKDFGSMNMD  60
ELLRNISTAE ETQSLMTASV PGGEGGVSGG NLQRQGSLTL PRTLSQKTVE EVWKDLFKEN  120
DGAKNVSNGG GGGGANLPQR QQTLGEMTLE EFLGRAGIVR EDMQSIGVPN NNGFFDNNSG  180
LALPFQQTNG NNGFLSNNNS VLNQPPILPL DVSGAKSSHS QQQQQPLFPK QQTVAFAPSM  240
HLINTTHFPS PGAQGSVVET SDLSMNTNLV QSSGLQSGGM GIVGLPSPAS HMSPDVISKN  300
SVDTTSFSPV PYVLGRGRKR SAALEKVVER RQRRMIKNRE SAARSRARKQ AYTLELEAEV  360
SKLKEMNEEL LRKQEEVMEM QKNQMLETLN PAWGGKRQCL RRTLTGPW*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX9643841e-122JX964384.1 Gossypium hirsutum clone NBRI_TRANS-653 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012462275.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 7
RefseqXP_012462274.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 7
RefseqXP_012462273.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 7
RefseqXP_012462272.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 7
SwissprotQ9M7Q31e-121AI5L6_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 6
TrEMBLA0A0D2TUQ20.0A0A0D2TUQ2_G
STRINGPOPTR_0009s10400.11e-160(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G45249.11e-95abscisic acid responsive elements-binding factor 2
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]