PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.013G039300.2
Common NameB456_013G039300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 351aa    MW: 39193.2 Da    PI: 8.6556
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.013G039300.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_125.33.3e-082162621763
                         HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1  17 ArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                         A+rsR RK+++i+eLe+ v++L+ae ++   ele l+++   l +e+
  Gorai.013G039300.2 216 AQRSRVRKLQYIAELERNVQALQAEGSEVSAELEFLNQQNLILSMEN 262
                         89***********************************9998887776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003380.0018205264IPR004827Basic-leucine zipper domain
CDDcd147037.63E-16207255No hitNo description
SuperFamilySSF579595.63E-6216258No hitNo description
Gene3DG3DSA:1.20.5.1701.9E-5216258No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MANSKGSTNI RNLMFSGKHA LLPPKSPFPT VASTYNDSAP NNVIGSKAIQ KPREGSTYHQ  60
RTSSESLLIE EQPSWLDDLL NEPETPVRRG GHRRSSSDSF AYIDDFDHHN CKDGRLNSFH  120
ADVNLVKQKH RAWDSSLNVV THPSGLPSLR ENTFVQSLGS CAPQELEQAQ STANGKQDST  180
KSAPIDAKAS SEKKDNSHAK SSASDSDTKR AKQQFAQRSR VRKLQYIAEL ERNVQALQAE  240
GSEVSAELEF LNQQNLILSM ENKALTQRLE SLAQEQAIKY LEQEVLEREI GRLRVLYQQQ  300
QNQQQPQQKQ QSSSHRRSSS RDLDSQFANL SVKEKDTSSS HDTVTGPLRI *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012463962.10.0PREDICTED: uncharacterized protein At4g06598-like
SwissprotQ8W3M73e-73Y4598_ARATH; Uncharacterized protein At4g06598
TrEMBLA0A0D2W2M50.0A0A0D2W2M5_G
STRINGGLYMA05G30170.31e-154(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G58110.22e-93bZIP family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]