PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.013G039300.1
Common NameB456_013G039300, LOC105783202
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 380aa    MW: 42370.7 Da    PI: 8.9279
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.013G039300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1254.1e-082452911763
                         HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1  17 ArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                         A+rsR RK+++i+eLe+ v++L+ae ++   ele l+++   l +e+
  Gorai.013G039300.1 245 AQRSRVRKLQYIAELERNVQALQAEGSEVSAELEFLNQQNLILSMEN 291
                         89***********************************9998887776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003380.0018234293IPR004827Basic-leucine zipper domain
CDDcd147034.87E-16236284No hitNo description
SuperFamilySSF579596.88E-6245287No hitNo description
Gene3DG3DSA:1.20.5.1706.5E-8245287No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MANSKGSTNI RNLMFSGKHA LLPPKSPFPT VASTYNDSAP NNVIGSKAIQ KPREGSTYHQ  60
RTSSESLLIE EQPSWLDDLL NEPETPVRRG GHRRSSSDSF AYIDVSNGPS LDYTAQDKYG  120
YKKMISGLSW ASQDFDHHNC KDGRLNSFHA DVNLVKQKHR AWDSSLNVVT HPSGLPSLRE  180
NTFVQSLGSC APQELEQAQS TANGKQDSTK SAPIDAKASS EKKDNSHAKS SASDSDTKRA  240
KQQFAQRSRV RKLQYIAELE RNVQALQAEG SEVSAELEFL NQQNLILSME NKALTQRLES  300
LAQEQAIKYL EQEVLEREIG RLRVLYQQQQ NQQQPQQKQQ SSSHRRSSSR DLDSQFANLS  360
VKEKDTSSSH DTVTGPLRI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012463962.10.0PREDICTED: uncharacterized protein At4g06598-like
SwissprotQ8W3M71e-75Y4598_ARATH; Uncharacterized protein At4g06598
TrEMBLA0A0D2VAA50.0A0A0D2VAA5_G
STRINGGLYMA05G30170.31e-170(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33602444
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G58110.21e-101bZIP family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]