PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.013G032900.2
Common NameB456_013G032900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family GATA
Protein Properties Length: 225aa    MW: 24380.6 Da    PI: 10.1686
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.013G032900.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA57.61.7e-18142175134
                GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                         Cs+C++ kTp+WR gp g ktLCnaCG++y++ +
  Gorai.013G032900.2 142 CSHCQVQKTPQWRTGPLGAKTLCNACGVRYKSGR 175
                         *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169929.5E-691223IPR016679Transcription factor, GATA, plant
SMARTSM004012.7E-14136190IPR000679Zinc finger, GATA-type
SuperFamilySSF577164.09E-14138199No hitNo description
Gene3DG3DSA:3.30.50.109.6E-15140173IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011411.332140172IPR000679Zinc finger, GATA-type
CDDcd002021.10E-13141190No hitNo description
PfamPF003202.4E-16142175IPR000679Zinc finger, GATA-type
PROSITE patternPS003440142167IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MMINDEIAGL EWVSHFVDDS VPEIPLPCPV FKQETDNHAG TRFEAETGPV FVKTPSFSSS  60
VPSKARSKRS KPTVPTWSVG SLPISESSSS TASSSSTCSG SSMTSTELAN GFRVPPTKKQ  120
KKKPVAVQGS GLSSGNPFQR RCSHCQVQKT PQWRTGPLGA KTLCNACGVR YKSGRLFPEY  180
RPACSPTFSG DLHSNSHRKV LEMRKRKELT VNDSVESTRL VPSF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gra.5941e-154seedling
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012463611.11e-162PREDICTED: GATA transcription factor 5-like
SwissprotQ9FH577e-53GATA5_ARATH; GATA transcription factor 5
TrEMBLA0A0D2W2F21e-164A0A0D2W2F2_G
STRINGPOPTR_0009s12620.14e-76(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.22e-47GATA transcription factor 5
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]