PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.013G021200.1
Common NameB456_013G021200, LOC105784056
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family GeBP
Protein Properties Length: 369aa    MW: 40204.3 Da    PI: 5.509
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.013G021200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573129.99.8e-41145241298
              DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifels 92 
                         lfqrl+se+Dei+lL G++d+ ak+g++p +d+++fyefvkksi+ +vsk ql++KirrLKkKfk++  k ++g++p+fsk+h+q++fels
  Gorai.013G021200.1 145 LFQRLFSEDDEIALLIGMLDYSAKKGADPCADMNEFYEFVKKSIHTDVSKVQLMDKIRRLKKKFKNNAGKNSKGEDPTFSKPHEQNAFELS 235
                         69***************************************************************************************** PP

              DUF573  93 kkiWgs 98 
                         k+iWg+
  Gorai.013G021200.1 236 KQIWGK 241
                         ****95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045042.9E-35146240IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MAPKRSNPIE VPPAASSSEE DEEVTSSEEV DEGSSTEEDP KTQSTPMSQK SPPPRKLETA  60
TPAIVKEGSD ESGSDSESDT AAQIAIATEP RCNKSLASSS KRPGKSELDA KEAKRLKKKV  120
GEEGMATAPV VEGVKKTGED AKKLLFQRLF SEDDEIALLI GMLDYSAKKG ADPCADMNEF  180
YEFVKKSIHT DVSKVQLMDK IRRLKKKFKN NAGKNSKGED PTFSKPHEQN AFELSKQIWG  240
KEGISGKVES STAKSNGKAK GKNKAEVAVK AELLSSSDKK IDDAVPVEVD EVVSKSSSNF  300
LDKKFSLSDL EEAVVKVGLD MVDGEKKAAL EAKWMKLQVA QLEAYARRTE FVAEQAKLLL  360
KYYKSEDK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ7512650.0JQ751265.1 Gossypium hirsutum GL1-enhancer binding protein (GeBP) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012465288.10.0PREDICTED: mediator-associated protein 1-like isoform X1
TrEMBLA0A0D2W2020.0A0A0D2W202_G
STRINGPOPTR_0001s30110.11e-61(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00390.12e-32DNA-binding storekeeper protein-related transcriptional regulator
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]