PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.013G005900.1
Common NameB456_013G005900, LOC105784364
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family LBD
Protein Properties Length: 213aa    MW: 23624 Da    PI: 8.2884
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.013G005900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260134.83.2e-42481471100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+k+l ++pe++r da+sslvyeA++r+rdPvyG++g i++lqqq+++l+
  Gorai.013G005900.1  48 PCAACKLLRRRCAEECPFSPYFSPHEPQKFASVHKVFGASNVSKMLMEVPENQRADAASSLVYEANVRLRDPVYGCMGAISALQQQVQSLQ 138
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                         ae++++++e
  Gorai.013G005900.1 139 AEINAVRAE 147
                         ****99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.58647148IPR004883Lateral organ boundaries, LOB
PfamPF031953.6E-4248145IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MSRERERFYE IGKKIKREAD VVSFGGHHHQ MGRRHMMGCH GTLNTITPCA ACKLLRRRCA  60
EECPFSPYFS PHEPQKFASV HKVFGASNVS KMLMEVPENQ RADAASSLVY EANVRLRDPV  120
YGCMGAISAL QQQVQSLQAE INAVRAEIMK HKCREANLIP SSSHLALLSS GAVSIATPPP  180
MPLPQPTTAA DYNTISDENV TYTLDNKYYL DN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012465673.11e-160PREDICTED: LOB domain-containing protein 15-like
SwissprotQ8L5T53e-82LBD15_ARATH; LOB domain-containing protein 15
TrEMBLA0A0D2S6501e-160A0A0D2S650_G
STRINGVIT_13s0067g02380.t011e-105(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19272781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.15e-74LOB domain-containing protein 15
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]