PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.012G151300.1
Common NameB456_012G151300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 372aa    MW: 41603 Da    PI: 7.3946
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.012G151300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_126.31.7e-082432891763
                         HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1  17 ArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                         A+rsR RK+++i+eLe+ v++L+ae ++   ele l+++   l +e+
  Gorai.012G151300.1 243 AQRSRGRKLQYIAELERNVQALQAEGSEVSAELEFLNQQNLILSMEN 289
                         99***********************************9998887776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.5E-4224291IPR004827Basic-leucine zipper domain
CDDcd147039.37E-15240282No hitNo description
SuperFamilySSF579593.15E-6240285No hitNo description
Gene3DG3DSA:1.20.5.1702.8E-8242285No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MANSKGSTNI RNLMFAGKHA LLPPKSPFPI ASPVYTDYIP NNVIGSKVIQ KSRVGSTYHQ  60
CTSSESHLIE EQPSWLDDLL NEPETPMYKG RHRRSSSDSF AFIDVSNAPN VDYGARDECR  120
YKSMISSPSW THQDFDHHNQ KDARVNSFHA NVNLVKQNNR AWDSTSLRES TFIQGLGSSC  180
TLEEPEAPPS TASEKKDSAE SASPNAKGSS EKKDNSHTKS SSSDTDSKRA KHTFVIVLSR  240
QFAQRSRGRK LQYIAELERN VQALQAEGSE VSAELEFLNQ QNLILSMENK ALKQRLESLA  300
QEQAIKYLEQ EVLEREIGRL RVMYQQQNQQ QPSSSHQCSS SRDLDSQFAN LSLKHNDTSS  360
SLDPITGPVR I*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012460807.10.0PREDICTED: uncharacterized protein At4g06598-like
SwissprotQ8W3M72e-62Y4598_ARATH; Uncharacterized protein At4g06598
TrEMBLA0A0D2W0Z90.0A0A0D2W0Z9_G
STRINGGLYMA05G30170.31e-152(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33602444
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G58110.27e-97bZIP family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]