PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.012G119600.1
Common NameB456_012G119600, LOC105780392
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family WRKY
Protein Properties Length: 512aa    MW: 55963.2 Da    PI: 7.5664
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.012G119600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.92e-33189247160
                         ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                         ++DgynWrKYGqK+vkgse+prsYY+Ct+++Cp+kkkvers  d++++ei+Y+g+Hnh+k
  Gorai.012G119600.1 189 VEDGYNWRKYGQKQVKGSENPRSYYKCTYPNCPTKKKVERSL-DGQITEIVYKGSHNHPK 247
                         58****************************************.***************85 PP

2WRKY104.84.5e-33354412159
                         ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                         ldDgy+WrKYGqK+vkg+++prsYY+Ct+ gCpv+k+ver+++d ++v++tYeg+Hnh+
  Gorai.012G119600.1 354 LDDGYRWRKYGQKVVKGNPNPRSYYKCTTIGCPVRKHVERASHDLRAVITTYEGKHNHN 412
                         59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.7E-27181248IPR003657WRKY domain
SuperFamilySSF1182902.48E-25184248IPR003657WRKY domain
SMARTSM007742.0E-36189247IPR003657WRKY domain
PfamPF031061.5E-25190246IPR003657WRKY domain
PROSITE profilePS5081123.479190248IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.5E-36339414IPR003657WRKY domain
SuperFamilySSF1182903.66E-29346414IPR003657WRKY domain
PROSITE profilePS5081137.975349414IPR003657WRKY domain
SMARTSM007745.6E-38354413IPR003657WRKY domain
PfamPF031062.9E-25355411IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009409Biological Processresponse to cold
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0010120Biological Processcamalexin biosynthetic process
GO:0010200Biological Processresponse to chitin
GO:0010508Biological Processpositive regulation of autophagy
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0070370Biological Processcellular heat acclimation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 512 aa     Download sequence    Send to blast
MAASSSSAFI NMDNNVNQST STNTTWPSFS DHNKFSTQVP NFKSFAPSPT LISPSSAFSP  60
TDFLDSPVLF STSALFSSPT TTGAFGGAQT VNWKNDSNDH QQGIKPKGFD FSFQVPQTQL  120
TLPSTTATTA FQSCSNTVSM EQPAWSLEKT GGEMVQFKPN MQSNTGSQPA GNYTSQYHQT  180
SQYMNNRKVE DGYNWRKYGQ KQVKGSENPR SYYKCTYPNC PTKKKVERSL DGQITEIVYK  240
GSHNHPKPQS TRGNRSSSSH SAEISDQSVG TLGNQLGDSF IMQDETSGSI DDDDFDQASS  300
AISNTNGCDD INENEPDAKR WKGENENEGM VGCGSKTVKE PRIVVQTTSD IDILDDGYRW  360
RKYGQKVVKG NPNPRSYYKC TTIGCPVRKH VERASHDLRA VITTYEGKHN HNVPAARGSG  420
YAMNRPSAVT ANMPIRPSAV PSQPNNTMYP NSGVSLGMLQ NNNNNNNTGS FGFSRLGKSI  480
GSSYMSQPHF SDGAFAKDEP RDDSFLDGLL S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-36189415878Probable WRKY transcription factor 4
2lex_A1e-36189415878Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00299DAPTransfer from AT2G38470Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC4146770.0KC414677.1 Gossypium hirsutum WRKY33 (WRKY33) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012460140.10.0PREDICTED: probable WRKY transcription factor 33
SwissprotQ8S8P51e-141WRK33_ARATH; Probable WRKY transcription factor 33
TrEMBLA0A0D2V4H90.0A0A0D2V4H9_G
STRINGPOPTR_0016s13600.11e-165(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM45832755
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.11e-135WRKY DNA-binding protein 33
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]