PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.012G094200.1
Common NameB456_012G094200, LOC105781058
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family LBD
Protein Properties Length: 206aa    MW: 22352.5 Da    PI: 5.2422
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.012G094200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260132.71.5e-41611601100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrr+C+++Cvlapyfp ++p+kf ++h++FGas+++k l++lpe++reda+ss+vyeA  r+rdPvyG++g i++lq+q++ l+
  Gorai.012G094200.1  61 PCAACKILRRRCVDKCVLAPYFPPTEPSKFIIAHRVFGASHIIKSLQELPESQREDAVSSMVYEASSRIRDPVYGCAGAIFQLQKQVSDLQ 151
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                         a+la++++e
  Gorai.012G094200.1 152 AQLAKAQAE 160
                         ****99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.36960161IPR004883Lateral organ boundaries, LOB
PfamPF031952.5E-4161158IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MENNERGSIS PISIPTTFSY SPSSSFSSPL SQFSPSLPSP DSQSSSPPRA AAASPQLVLS  60
PCAACKILRR RCVDKCVLAP YFPPTEPSKF IIAHRVFGAS HIIKSLQELP ESQREDAVSS  120
MVYEASSRIR DPVYGCAGAI FQLQKQVSDL QAQLAKAQAE VVTLQCQQAN VLTLILEMSQ  180
SKEPIDTTCF LDDTCIVSPW EPLWT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012461085.11e-147PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR06e-71LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A0D2V4981e-147A0A0D2V498_G
STRINGPOPTR_0008s04350.14e-83(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM114128105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.15e-71LOB domain-containing protein 1
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]