PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.012G083100.1
Common NameB456_012G083100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family CO-like
Protein Properties Length: 436aa    MW: 48779.7 Da    PI: 5.2598
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.012G083100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box248.3e-081656337
            zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......H 37
                        + +C  +++k++ l+C  ++  lC  C ++ H+       H
  Gorai.012G083100.1 16 MSVCHFCNSKPAVLYCSADSARLCLFCDQQVHSAnalslkH 56
                        789*****************************655666666 PP

2zf-B_box20.11.3e-065992336
            zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg 36
                         ++C+ ++ k++++ C  ++ +lC+dC  ++H+ 
  Gorai.012G083100.1 59 SQICDGCKAKPASFLCSIDNLMLCHDCDWSSHNK 92
                        689*****************************64 PP

3CCT62.41.4e-21385429145
                 CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqae 45 
                         R++a+lRYkeK+k+R+++K+irYesRK++A++R+R KGrFvk++e
  Gorai.012G083100.1 385 RDNAMLRYKEKKKHRRYDKQIRYESRKTRADTRKRFKGRFVKASE 429
                         899***************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.6411461IPR000315B-box-type zinc finger
SMARTSM003364.1E-91461IPR000315B-box-type zinc finger
PfamPF006435.2E-61658IPR000315B-box-type zinc finger
CDDcd000211.07E-51849No hitNo description
PROSITE profilePS501199.10157116IPR000315B-box-type zinc finger
CDDcd000216.25E-46187No hitNo description
SMARTSM003363.162116IPR000315B-box-type zinc finger
PROSITE profilePS5101714.733385427IPR010402CCT domain
PfamPF062031.1E-15385427IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 436 aa     Download sequence    Send to blast
MMMSRVPKPK PRRSTMSVCH FCNSKPAVLY CSADSARLCL FCDQQVHSAN ALSLKHVRSQ  60
ICDGCKAKPA SFLCSIDNLM LCHDCDWSSH NKNNNNINSS SSSNSCVSAM HERAPVEGFS  120
GRPSVVELAS LFGFDLKPKD LMNLIPGFSL YERELMNLED FMVPEEENSC VSSALISSVK  180
LDHEVYRQLV DMGKRDLVRG SGDGAELGPG TPPITSAEQE NFATFEVENG DDEEQLQQQT  240
PFTSLLTLQS DDVLRQNDYV AEGELVWDCK SSYLPSQIWD FQSERSKDCE ESGAEDAGFV  300
KGCSFFRNNT CNEPFSSCKP TTEESNNVGV VGSLSDSKVV ESLETPTCDS TRYVQVMEHP  360
IVGGSEVMNY EAKTNVDMEP LAQNRDNAML RYKEKKKHRR YDKQIRYESR KTRADTRKRF  420
KGRFVKASEA PDVRV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ3936025e-58GQ393602.1 Gossypium hirsutum cultivar Deltapine 33 B clone MONCS0567 SSR marker CGR5610 genomic sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012460934.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 14-like
TrEMBLA0A0D2TKT80.0A0A0D2TKT8_G
STRINGVIT_14s0068g01380.t011e-101(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1922677
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33500.12e-69B-box type zinc finger protein with CCT domain
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]