PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.012G073400.1
Common NameB456_012G073400, LOC105779268
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 250aa    MW: 28591.4 Da    PI: 9.6571
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.012G073400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1319e-41331621128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeek..ewyfFskrdkkyatgkrknratksgyWkat 86 
                         +p GfrF+P+d+el+ +yL  k+++k+l+  + ikev +yk++P +L +   +++++ +  ewyfF++rd+k+++gkr+nra+ +g+Wka 
  Gorai.012G073400.1  33 MPSGFRFKPRDDELI-FYLMCKARNKPLPP-TRIKEVPLYKYDPDTLTAisgNMSSNGTinEWYFFTSRDRKHPQGKRPNRAAGDGFWKAV 121
                         699************.9**********999.67**************85456444433345****************************** PP

                 NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          +dk+v+s +g+l+glkktLv+ +g+ +k++kt+W+mhey l
  Gorai.012G073400.1 122 NSDKHVKS-NGKLIGLKKTLVYCRGKPSKAQKTNWIMHEYVL 162
                         ********.99*****************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.29E-4630187IPR003441NAC domain
PROSITE profilePS5100544.92933187IPR003441NAC domain
PfamPF023651.4E-2134162IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MSINKSAAME EDGNQELMVR MKEAEDEAYL KSMPSGFRFK PRDDELIFYL MCKARNKPLP  60
PTRIKEVPLY KYDPDTLTAI SGNMSSNGTI NEWYFFTSRD RKHPQGKRPN RAAGDGFWKA  120
VNSDKHVKSN GKLIGLKKTL VYCRGKPSKA QKTNWIMHEY VLSDPPQTTH KNDHQLDGWA  180
LCRVYNRKPQ APKVPEKSSP QNFGSNNLNI QNQIQEQSAL QNFVTEDLNF SESDKFLLYA  240
NFGTIIYSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A9e-44181883169Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, stem, flowers, and leaves. {ECO:0000269|PubMed:29760199}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds DNA motifs 5'-CGT[AG](5N)NACG[ACT][AC][AT][ACG][ACT]-3' and 5'-CACG[ACT][AC][AT][AGT][CT]-3' in target genes promoters. Promotes leaf senescence and reduces fruit yield and sugar content, probably by establishing abscisic acid (ABA) homeostasis. {ECO:0000269|PubMed:29760199}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Accumulates during age-dependent and dark-induced leaf senescence. {ECO:0000269|PubMed:29760199}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012458487.10.0PREDICTED: NAC domain-containing protein 68-like
SwissprotK4BWV21e-46NAP1_SOLLC; NAC domain-containing protein 1
TrEMBLA0A0D2TK120.0A0A0D2TK12_GOSRA; Uncharacterized protein
STRINGGorai.012G073400.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2481734
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77450.14e-47NAC domain containing protein 32
Publications ? help Back to Top
  1. Tomato Genome Consortium
    The tomato genome sequence provides insights into fleshy fruit evolution.
    Nature, 2012. 485(7400): p. 635-41
    [PMID:22660326]
  2. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  3. Ma X, et al.
    The NAC Transcription Factor SlNAP2 Regulates Leaf Senescence and Fruit Yield in Tomato.
    Plant Physiol., 2018. 177(3): p. 1286-1302
    [PMID:29760199]