PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.012G054800.1
Common NameB456_012G054800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 333aa    MW: 38254.3 Da    PI: 7.5899
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.012G054800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.81.7e-52111381128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         + pGfrFhPtdeelv +yLk+k+++k+l++ + i+++diyk+ePwdLpk ++++ekewyf+++rd+ky+++ r+nr+t+ g+Wkatg+d++
  Gorai.012G054800.1  11 MLPGFRFHPTDEELVEFYLKNKIQQKSLPI-QLITQLDIYKYEPWDLPKLAASGEKEWYFYCPRDRKYRNSARPNRVTRGGFWKATGTDRP 100
                         579***************************.89***************8888899************************************ PP

                 NAM  92 vlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++s+  ++ +glkk+Lvfy+gra kg ktdW+mhe+rl
  Gorai.012G054800.1 101 IYSSdATKCIGLKKSLVFYRGRAAKGIKTDWMMHEFRL 138
                         ***856667***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.89E-579171IPR003441NAC domain
PROSITE profilePS5100555.85811171IPR003441NAC domain
PfamPF023653.1E-2613138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MDDVEKVEDV MLPGFRFHPT DEELVEFYLK NKIQQKSLPI QLITQLDIYK YEPWDLPKLA  60
ASGEKEWYFY CPRDRKYRNS ARPNRVTRGG FWKATGTDRP IYSSDATKCI GLKKSLVFYR  120
GRAAKGIKTD WMMHEFRLPS LSDKTLSANV MILIRSLISN DSWAICKIFR KTNCMAQRAL  180
SHTSIPSDIP HHYGPFNHFN EVQHAQQWTT SPLPVPNGDL HNNSMFLQCT VDTSSVVLSP  240
DATMIADDVR NNSESIDFKG KQQSFNGFSI RLPQDMEGTR NDDGDWRSIP LMGFPFSLSP  300
NVLDSWKPNL PWDTSLYPTE MSTTYSTDRY HT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-511317317170Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012458499.10.0PREDICTED: putative NAC domain-containing protein 94
SwissprotQ9FIW54e-96NAC94_ARATH; Putative NAC domain-containing protein 94
TrEMBLA0A0D2TJ270.0A0A0D2TJ27_GOSRA; Uncharacterized protein
STRINGGorai.012G054800.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30628200
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39820.12e-98NAC domain containing protein 94
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]