PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.012G037600.2
Common NameB456_012G037600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 223aa    MW: 25738.2 Da    PI: 6.7961
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.012G037600.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM951.2e-2957754128
                 NAM  54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         +ekewyfFs+rd+ky++g r+nra+ +gyWkatg dk++ +   ++ g+kk Lvfy g+ap+g+kt+W+mheyrl
  Gorai.012G037600.2   5 GEKEWYFFSPRDRKYPNGCRPNRAAGTGYWKATGADKPIGK--PKTLGIKKALVFYAGKAPRGVKTNWIMHEYRL 77 
                         579************************************98..778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100540.7341104IPR003441NAC domain
SuperFamilySSF1019415.89E-363104IPR003441NAC domain
PfamPF023656.9E-15977IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008361Biological Processregulation of cell size
GO:0009416Biological Processresponse to light stimulus
GO:0009611Biological Processresponse to wounding
GO:0009620Biological Processresponse to fungus
GO:0009744Biological Processresponse to sucrose
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0043424Molecular Functionprotein histidine kinase binding
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MALYGEKEWY FFSPRDRKYP NGCRPNRAAG TGYWKATGAD KPIGKPKTLG IKKALVFYAG  60
KAPRGVKTNW IMHEYRLANV DRSAGKKSNN LRLDDWVLCR IYNKKGSIEK HFPSEQKSLS  120
YPEMEDEKPD IIMNGQNMQQ PWSVMAMKND VIQTDGSESS WSEHVPSPEI TWEKEVKSEG  180
RWNELDFGLD FIDEDPFASQ VDYQMEQLSP LQDMFMYLPK TF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-50211064174Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, cotyledons, rosette leaves, cauline leaves and mature flowers. Expressed at low levels in stems and flower buds. {ECO:0000269|PubMed:16115070}.
Functional Description ? help Back to Top
Source Description
UniProtInvolved in disease resistance response (PubMed:16115070, PubMed:19625399). May function as repressor of pathogenesis-related proteins (PubMed:16115070). May function in the regulation of host basal defense responses against viral infection (PubMed:19625399). Transcriptional activator involved in responses to wounding and infection with tobamovirus (TMV) (PubMed:22937923). Binds to the DNA sequences 5'-AAAATATCT-3' and 5'AGATTTTT-3' of CYP734A1/BAS1 and CYP72C1/SOB7 promoters, respectively. Acts as suppressor of the brassinosteroid (BR)-inactivating enzymes CYP734A1/BAS1 and CYP72C1/SOB7, and prevents their expression in almost all tissues. Plays a central role in integrating BR homeostasis and seedling development. Regulates the spatial regulation of BR homeostasis and participates in the regulation of hypocotyl elongation and root growth by suppressing BR catabolism. Mediates connection between BR catabolism and photomorphogenesis (PubMed:26493403). Binds to, and transactivates the promoter of the auxin biosynthetic gene NIT2 (PubMed:22965747). Stress-responsive NAC transcription factor involved in ABA-inducible leaf senescence signaling (PubMed:26518251). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:16115070, ECO:0000269|PubMed:18849494, ECO:0000269|PubMed:19625399, ECO:0000269|PubMed:22937923, ECO:0000269|PubMed:22965747, ECO:0000269|PubMed:26493403, ECO:0000269|PubMed:26518251}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by wounding, salicylic acid (SA), methyl jasmonate, drought stress, dark and sucrose starvation (PubMed:16115070). Induced by chitin elicitor (chitooctaose) (PubMed:17722694). Induced by salicylic acid and infection with tobamovirus (TMV) (PubMed:19625399). By indole-3-acetonitrile, salicylic acid (SA), sodium nitroprusside (SNP), salt stress and drought stress (PubMed:22965747). Down-regulated by brassinosteroid (BR) and transition from dark to white light (PubMed:26493403). {ECO:0000269|PubMed:16115070, ECO:0000269|PubMed:17722694, ECO:0000269|PubMed:19625399, ECO:0000269|PubMed:22965747, ECO:0000269|PubMed:26493403}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU7063380.0EU706338.1 Gossypium hirsutum NAC domain protein NAC1 (NAC1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016751388.11e-167PREDICTED: protein ATAF2-like isoform X2
SwissprotQ9C5985e-82NAC81_ARATH; Protein ATAF2
TrEMBLA0A0D2V1B41e-166A0A0D2V1B4_GOSRA; Uncharacterized protein
TrEMBLA0A1U8PM361e-166A0A1U8PM36_GOSHI; protein ATAF2-like isoform X2
STRINGGorai.012G037600.11e-165(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08790.12e-84NAC family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  2. Takasaki H, et al.
    SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence.
    Plant J., 2015. 84(6): p. 1114-23
    [PMID:26518251]