PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.012G036100.1
Common NameB456_012G036100, LOC105779242
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 205aa    MW: 23729 Da    PI: 5.3195
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.012G036100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM108.29.6e-34121301128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrF Ptdeelv ++L +k  + ++   ++i+e+d+++++Pw+L+ k+  + k+++fFs++         +nr+ ++gyWk+   +++
  Gorai.012G036100.1  12 LPPGFRFCPTDEELVLHFLYPKSLRLPCYS-NIIPELDLHRLHPWELDGKALMSGKRYFFFSQK--------MENRVLENGYWKQLDMEEP 93 
                         79*************************988.89**************96555556666666665........3589*************** PP

                 NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++s ++ +vg+kk + fy g ap g kt+Wvm+ey+l
  Gorai.012G036100.1  94 IFSGGSGKVGVKKLFEFYIGGAPFGMKTNWVMQEYHL 130
                         ****9******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.22E-427161IPR003441NAC domain
PROSITE profilePS5100538.71712164IPR003441NAC domain
PfamPF023653.8E-2113130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MEMEDGRSVN HLPPGFRFCP TDEELVLHFL YPKSLRLPCY SNIIPELDLH RLHPWELDGK  60
ALMSGKRYFF FSQKMENRVL ENGYWKQLDM EEPIFSGGSG KVGVKKLFEF YIGGAPFGMK  120
TNWVMQEYHL CNWGSALSFH YPKTKGIRKL DSNYKWVLCK VEEHKGNAQS FNYSDEDGSE  180
LSCLDEMFLS LDDDLDDISS SHFL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-311216917170NO APICAL MERISTEM PROTEIN
1ut4_B1e-311216917170NO APICAL MERISTEM PROTEIN
1ut7_A1e-311216917170NO APICAL MERISTEM PROTEIN
1ut7_B1e-311216917170NO APICAL MERISTEM PROTEIN
3swm_A1e-311216920173NAC domain-containing protein 19
3swm_B1e-311216920173NAC domain-containing protein 19
3swm_C1e-311216920173NAC domain-containing protein 19
3swm_D1e-311216920173NAC domain-containing protein 19
3swp_A1e-311216920173NAC domain-containing protein 19
3swp_B1e-311216920173NAC domain-containing protein 19
3swp_C1e-311216920173NAC domain-containing protein 19
3swp_D1e-311216920173NAC domain-containing protein 19
4dul_A1e-311216917170NAC domain-containing protein 19
4dul_B1e-311216917170NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5789708e-86JX578970.1 Gossypium hirsutum clone NBRI_GE11114 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012458466.11e-151PREDICTED: NAC domain-containing protein 68-like isoform X2
TrEMBLA0A0D2V1741e-150A0A0D2V174_GOSRA; Uncharacterized protein
STRINGGorai.012G036100.11e-150(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36742862
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64530.11e-40xylem NAC domain 1
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]