PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.012G010900.4
Common NameB456_012G010900, LOC105780460
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NF-YA
Protein Properties Length: 308aa    MW: 33658.7 Da    PI: 8.4677
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.012G010900.4genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA98.95.4e-31158214158
           CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                         de++YVNaKQy +Il+RRq Rakle+++kl +k rkpylheSRh hAl+R+Rg+gGrF
  Gorai.012G010900.4 158 DETIYVNAKQYGAILRRRQYRAKLEAQNKL-IKVRKPYLHESRHLHALKRARGNGGRF 214
                         699***************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005216.1E-36156217IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115235.631157217IPR001289Nuclear transcription factor Y subunit A
PfamPF020453.4E-25160214IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.7E-21160182IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860162182IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.7E-21191214IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MESHVQQSSM SESLNLNMGI VPQHFHNSKQ LSFQFQDQDS SSTQSTGQSY PEAASVGDSN  60
LYRQSSISAS SGGNETPGKL VEHHAKLASS MGTQEYVFSP SQVDYSKSIQ AHIPLHYAEP  120
YFGGVVTAVC PPQAMIHHPC MLAMLPARVP LPLELTEDET IYVNAKQYGA ILRRRQYRAK  180
LEAQNKLIKV RKPYLHESRH LHALKRARGN GGRFLNTKKL QESKPIPTSH GLDASRSPQL  240
HLCANMSNQL ENYKDAASTT TCSDVTSASN SDEMLQQPDF RFSGYSSLIA GATRGSGGNL  300
HHLSGCG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A6e-19158218262NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:11250072, ECO:0000269|PubMed:9662544}.
Functional Description ? help Back to Top
Source Description
UniProtStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012460269.10.0PREDICTED: nuclear transcription factor Y subunit A-3 isoform X1
RefseqXP_012460270.10.0PREDICTED: nuclear transcription factor Y subunit A-3 isoform X1
RefseqXP_012460272.10.0PREDICTED: nuclear transcription factor Y subunit A-3 isoform X3
RefseqXP_012460273.10.0PREDICTED: nuclear transcription factor Y subunit A-3 isoform X3
SwissprotQ93ZH21e-76NFYA3_ARATH; Nuclear transcription factor Y subunit A-3
TrEMBLA0A0D2V0530.0A0A0D2V053_GOSRA; Uncharacterized protein
TrEMBLA0A0D2V0C10.0A0A0D2V0C1_GOSRA; Uncharacterized protein
STRINGGorai.012G010900.10.0(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.12e-71nuclear factor Y, subunit A3
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]