PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.012G007100.3
Common NameB456_012G007100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 225aa    MW: 25907.3 Da    PI: 4.4927
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.012G007100.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.93.4e-11114156446
                         XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLk 46 
                         +k++rrk +NR AA rsR+RKk++++ Le k+  Le+e ++L 
  Gorai.012G007100.3 114 DKKQRRKLRNRDAAVRSRERKKMYVKDLEMKSRYLEGECRRLN 156
                         79************************************98886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1702.3E-12110174No hitNo description
SMARTSM003387.3E-8111175IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.91113155IPR004827Basic-leucine zipper domain
PfamPF001702.2E-9114156IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.19E-10115172No hitNo description
CDDcd147044.73E-16116167No hitNo description
PROSITE patternPS000360118133IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MEETNWESLL FEFDFPNLGN ILQNESESVS PPISTHSPDE KPIWTSSIGE IEKLLMEDDR  60
FDDKVETQPI PNEFLADLLV DSSPSGCGDE VIDDTAFDKQ NQTLFNVDND DPIDKKQRRK  120
LRNRDAAVRS RERKKMYVKD LEMKSRYLEG ECRRLNCLLQ WSIAENQALR FTLNQRCAFD  180
ASSAKQESAV LLLGTIRFHK LLIHCIVLYF ILQSEEISVL LLSF*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1117123RRKLRNR
2117134RRKLRNRDAAVRSRERKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012459325.11e-138PREDICTED: bZIP transcription factor 60-like
TrEMBLA0A0D2UZQ81e-165A0A0D2UZQ8_G
STRINGPOPTR_0005s27930.12e-40(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G42990.11e-15basic region/leucine zipper motif 60
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]