PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.012G007000.1
Common NameB456_012G007000, LOC105779892
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 444aa    MW: 49577.8 Da    PI: 6.7423
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.012G007000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.71.1e-53261531128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                         l+pGfrFhPtdeelv++yLk+kv++k++++ ++i+evdiyk+ePwdL   +++k++++ewyfFs  dkky +g r nrat++gyWkatgkd
  Gorai.012G007000.1  26 LAPGFRFHPTDEELVSYYLKRKVTNKPVRF-NAIAEVDIYKHEPWDLSdkSRLKTRDQEWYFFSLLDKKYGNGGRMNRATNQGYWKATGKD 115
                         579************************999.89**************85348899999********************************* PP

                 NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         +ev + +++l+g+kktLvf++grap+g +t+Wvmheyrl
  Gorai.012G007000.1 116 REVRH-NDQLMGMKKTLVFHNGRAPDGLRTNWVMHEYRL 153
                         *****.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.15E-6123176IPR003441NAC domain
PROSITE profilePS5100557.76626175IPR003441NAC domain
PfamPF023651.3E-2728153IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 444 aa     Download sequence    Send to blast
MRGENSLAIV TAPSAAAETG GSATALAPGF RFHPTDEELV SYYLKRKVTN KPVRFNAIAE  60
VDIYKHEPWD LSDKSRLKTR DQEWYFFSLL DKKYGNGGRM NRATNQGYWK ATGKDREVRH  120
NDQLMGMKKT LVFHNGRAPD GLRTNWVMHE YRLVEEELER IGTLQGYVLC RVFHKNNIGP  180
PNGNRYAPFI EAEWDDGSAV LVPGIDIGDD GVASEKALVE SNGVQRSGFE QEIQNADEEA  240
PANDKVRREL LNERTYDCPP LPPGKIERLD NGPPLCLINR EAPLPLIHYK RRRQNDSGPS  300
HANISENSTR TTQDHCSSTT TAGTTTASPS SDTTTAVSAL LEFSLMESIE PKKKKPHVPP  360
PIYETANLDS MVPPGCMKLI TDLQNEIRKI SAERETLKLE MMSAQAMINI LQSKVDFLSK  420
ENEDLKRNNR ELRGGSVGSC SHP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-462517716167NO APICAL MERISTEM PROTEIN
1ut4_B6e-462517716167NO APICAL MERISTEM PROTEIN
1ut7_A6e-462517716167NO APICAL MERISTEM PROTEIN
1ut7_B6e-462517716167NO APICAL MERISTEM PROTEIN
3swm_A6e-462517719170NAC domain-containing protein 19
3swm_B6e-462517719170NAC domain-containing protein 19
3swm_C6e-462517719170NAC domain-containing protein 19
3swm_D6e-462517719170NAC domain-containing protein 19
3swp_A6e-462517719170NAC domain-containing protein 19
3swp_B6e-462517719170NAC domain-containing protein 19
3swp_C6e-462517719170NAC domain-containing protein 19
3swp_D6e-462517719170NAC domain-containing protein 19
4dul_A6e-462517716167NAC domain-containing protein 19
4dul_B6e-462517716167NAC domain-containing protein 19
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Mostly expressed in floral organs, and, at low levels, in other organs. {ECO:0000269|PubMed:25578968}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional repressor that binds to the motif 5'-(C/T)A(C/A)G-3' in the promoter of target genes (PubMed:25578968). Binds also to the 5'-CTTGNNNNNCAAG-3' consensus sequence in chromatin (PubMed:26617990). Can bind to the mitochondrial dysfunction motif (MDM) present in the upstream regions of mitochondrial dysfunction stimulon (MDS) genes involved in mitochondrial retrograde regulation (MRR) (PubMed:24045019). Together with NAC050 and JMJ14, regulates gene expression and flowering time by associating with the histone demethylase JMJ14, probably by the promotion of RNA-mediated gene silencing (PubMed:25578968, PubMed:26617990). Regulates siRNA-dependent post-transcriptional gene silencing (PTGS) through SGS3 expression modulation (PubMed:28207953). Required during pollen development (PubMed:19237690). {ECO:0000269|PubMed:19237690, ECO:0000269|PubMed:24045019, ECO:0000269|PubMed:25578968, ECO:0000269|PubMed:26617990, ECO:0000269|PubMed:28207953}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00612ChIP-seqTransfer from AT3G10490Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by type III effector proteins (TTEs) secreted by the pathogenic bacteria P.syringae pv. tomato DC3000 during basal defense. {ECO:0000269|PubMed:16553893}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC8472460.0KC847246.1 Gossypium hirsutum NAC domain protein NAC69 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012459323.10.0PREDICTED: uncharacterized protein LOC105779892
SwissprotQ9SQY01e-154NAC52_ARATH; NAC domain containing protein 52
TrEMBLA0A0D2UZX40.0A0A0D2UZX4_GOSRA; Uncharacterized protein
STRINGGorai.012G007000.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17802880
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10480.21e-139NAC domain containing protein 50
Publications ? help Back to Top
  1. Higgins JD,Ferdous M,Osman K,Franklin FC
    The RecQ helicase AtRECQ4A is required to remove inter-chromosomal telomeric connections that arise during meiotic recombination in Arabidopsis.
    Plant J., 2011. 65(3): p. 492-502
    [PMID:21265901]
  2. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. Zhang S, et al.
    C-terminal domains of a histone demethylase interact with a pair of transcription factors and mediate specific chromatin association.
    Cell Discov, 2019.
    [PMID:26617990]
  5. Butel N,Le Masson I,Bouteiller N,Vaucheret H,Elmayan T
    sgs1: a neomorphic nac52 allele impairing post-transcriptional gene silencing through SGS3 downregulation.
    Plant J., 2017. 90(3): p. 505-519
    [PMID:28207953]
  6. Elmayan T, et al.
    Arabidopsis mutants impaired in cosuppression.
    Plant Cell, 1998. 10(10): p. 1747-58
    [PMID:9761800]