PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.011G271300.1
Common NameB456_011G271300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 361aa    MW: 40958.2 Da    PI: 5.0211
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.011G271300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM137.39.5e-43131422128
                 NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk.....kvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                         ppG+rF+P+d+e++++yL++k+ g +l+  + ikev +y+++P++L +       ++  +e+yfF++rd+kya+g+r+ r + +gyWkatg
  Gorai.011G271300.1  13 PPGYRFKPRDDEIINFYLRPKIFGLPLPP-NRIKEVLLYNYDPQTLTAmsnnaLSNGVGNEYYFFTPRDRKYANGSRPARNAGNGYWKATG 102
                         9*************************999.77**************8434443222245699***************************** PP

                 NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          dk +++ kg+++glkk+Lvfy+g+ pkg+kt+W+mhey l
  Gorai.011G271300.1 103 ADKLICR-KGKKIGLKKSLVFYQGKPPKGVKTNWLMHEYVL 142
                         *****99.9999***************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-5211168IPR003441NAC domain
PROSITE profilePS5100550.85212169IPR003441NAC domain
PfamPF023656.9E-2313142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MEEKDEACLR SIPPGYRFKP RDDEIINFYL RPKIFGLPLP PNRIKEVLLY NYDPQTLTAM  60
SNNALSNGVG NEYYFFTPRD RKYANGSRPA RNAGNGYWKA TGADKLICRK GKKIGLKKSL  120
VFYQGKPPKG VKTNWLMHEY VLTDAPIRKR LGNEDMRLDD WVLCRVYKNP RVKKLEHETL  180
EDGNQEEADT ATTVAYDGAQ MVQQEGHQVE CEAEAARSAI PPYNGIQMVE NGIAFATLYE  240
PINTSSQMLE HGIAPLYEPI NTSSQMLENG IAFAPLYEPI NVQMPQGTSS WFPEQVYSTP  300
YFNQYGDYTF EHPTLEGFNM PDCGVYDPAL FQINMQQHFS SDFDLDQLNQ DPHSGLPPPL  360
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-5011696165NO APICAL MERISTEM PROTEIN
1ut4_B2e-5011696165NO APICAL MERISTEM PROTEIN
1ut7_A2e-5011696165NO APICAL MERISTEM PROTEIN
1ut7_B2e-5011696165NO APICAL MERISTEM PROTEIN
3swm_A2e-5011699168NAC domain-containing protein 19
3swm_B2e-5011699168NAC domain-containing protein 19
3swm_C2e-5011699168NAC domain-containing protein 19
3swm_D2e-5011699168NAC domain-containing protein 19
3swp_A2e-5011699168NAC domain-containing protein 19
3swp_B2e-5011699168NAC domain-containing protein 19
3swp_C2e-5011699168NAC domain-containing protein 19
3swp_D2e-5011699168NAC domain-containing protein 19
4dul_A2e-5011696165NAC domain-containing protein 19
4dul_B2e-5011696165NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC8472490.0KC847249.1 Gossypium hirsutum NAC domain protein NAC72 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017604773.19e-87PREDICTED: uncharacterized protein LOC108451615
TrEMBLA0A0D2UYM40.0A0A0D2UYM4_GOSRA; Uncharacterized protein
STRINGGorai.011G271300.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2885323
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.18e-54NAC-like, activated by AP3/PI
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]