PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.011G269400.1
Common NameB456_011G269400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 359aa    MW: 41472.6 Da    PI: 5.9162
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.011G269400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1479.7e-46171461127
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk.....kvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                         l pG+rF+P+deelv++yL++k++g +l+  + i+e+++y ++P++L +     + ++ ekewyfF++r++ky++g+r+ r++ +gyWkat
  Gorai.011G269400.1  17 LHPGYRFKPRDEELVNYYLRPKISGLPLPP-NRIREANLYGHDPETLTAmnnytSSNEVEKEWYFFTPRERKYTNGSRPARKAGNGYWKAT 106
                         579************************999.77**************84355443333566****************************** PP

                 NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyr 127
                         g dkev+  kg+++g+kktLvfy+g+ p+g kt+W+mhey 
  Gorai.011G269400.1 107 GADKEVIL-KGKKIGCKKTLVFYEGKPPRGFKTNWTMHEYV 146
                         ********.9999***************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.36E-5216173IPR003441NAC domain
PROSITE profilePS5100551.14117174IPR003441NAC domain
PfamPF023651.6E-2519146IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MLKKQKEEEE EEYFRLLHPG YRFKPRDEEL VNYYLRPKIS GLPLPPNRIR EANLYGHDPE  60
TLTAMNNYTS SNEVEKEWYF FTPRERKYTN GSRPARKAGN GYWKATGADK EVILKGKKIG  120
CKKTLVFYEG KPPRGFKTNW TMHEYVSSEA PVRVRHGKED MKLDNWVLCR LYKNRREAKQ  180
KHRIPQEENG LECQEKVEPH KMAEPVSEPI NMVAPPVYDQ YEQREVQPFN MNIGQDTNRF  240
PELDNPMPVS DEYGNYYMFD NNPTHGGGFQ QVPNYDDFVT NAAAAPAPFS STFPLDNQFQ  300
SMGNAGFNLP PPPLQFQPHW PAPPSPPQQF LGANTGFDFS VDEYLLDPEF GMPPPEFC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-4651773171Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor of the NAC family associated with male fertility. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC8472540.0KC847254.1 Gossypium hirsutum NAC domain protein NAC77 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotA2YMR05e-50NAC10_ORYSI; NAC transcription factor ONAC010
TrEMBLA0A0D2UYK10.0A0A0D2UYK1_GOSRA; Uncharacterized protein
STRINGGorai.011G269400.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17827310
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77450.13e-52NAC domain containing protein 32
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]