PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.011G257000.1
Common NameB456_011G257000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 270aa    MW: 30409.1 Da    PI: 4.7216
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.011G257000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM68.81.5e-21331562128
                 NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykv..ePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                         p+GfrF Pt ee++++yL++ ++g++++   v++e++iy    ePw++    ++++ e  f++ ++ k+++++r  r++ +g W ++  ++
  Gorai.011G257000.1  33 PVGFRFLPTKEEILCDYLQPFIKGDPIPS-GVMEELNIYGEnrEPWNIF---NQDSAEESFWVITKLKKKSKSRIDRTAGDGCWLQQYIKE 119
                         89**************************9.99******964449****5...344456667777777777899************998866 PP

                 NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                            s +ge++g  k + + +++++k ++ +W mhe++l
  Gorai.011G257000.1 120 VKNSDGGEVIGYDKYFKYTRKKSQK-SNGQWSMHEFSL 156
                         555669999*********9766666.89********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.53E-2428175IPR003441NAC domain
PROSITE profilePS5100525.48432175IPR003441NAC domain
PfamPF023652.0E-1333156IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MVRQRMLEEQ NTLDVRGEDG EESGEESPQL QIPVGFRFLP TKEEILCDYL QPFIKGDPIP  60
SGVMEELNIY GENREPWNIF NQDSAEESFW VITKLKKKSK SRIDRTAGDG CWLQQYIKEV  120
KNSDGGEVIG YDKYFKYTRK KSQKSNGQWS MHEFSLKDQE ALGLSDYVIC EIKNKDAAVV  180
SPDYEECEGE INKKKKRKLM EVPSTSTNHF AFVPLGNQSF DYMAPEAGGF SPSPPFTACL  240
NQQPNPWTSA GVGGNLGVPD YNSHQLVPA*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1192197KKKKRK
2193198KKKRKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5963951e-48JX596395.1 Gossypium hirsutum clone NBRI_GE32970 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012455880.10.0PREDICTED: NAC domain-containing protein 48-like
TrEMBLA0A0D2TDQ00.0A0A0D2TDQ0_GOSRA; Uncharacterized protein
STRINGGorai.011G257000.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16345312
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.11e-15NAC domain containing protein 83
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]