PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.011G238800.3
Common NameB456_011G238800, LOC105776947
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family GATA
Protein Properties Length: 338aa    MW: 36797.1 Da    PI: 6.7839
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.011G238800.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.11e-17252285134
                GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                         C +C  tkTp+WR gp g+ktLCnaCG++y++ +
  Gorai.011G238800.3 252 CMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGR 285
                         99*****************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169923.8E-762333IPR016679Transcription factor, GATA, plant
SMARTSM004015.1E-17246296IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.279246282IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.109.6E-15250283IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577164.56E-15250309No hitNo description
CDDcd002023.16E-14251308No hitNo description
PROSITE patternPS003440252277IPR000679Zinc finger, GATA-type
PfamPF003202.3E-15252285IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009845Biological Processseed germination
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MIGPTNFIDE IDCGSFFDHI DDLLDFPNED VEAGFSAPDS AVNAAAFPSI WTAHPESFPG  60
SDSVFSNNSA SDLSAELSVP YEDIVQLEWL SNFVEDSNCG ASLTIKKQEP NSNNKDSPSH  120
HDHDHHQFQT SSPVSVLESS SSYSGEKPVA APGKCGRARS KRPRPATFNP RPAIQLISPS  180
SSVNDNDVPQ SLFVPKVPSD SENHAESRLL IKLPRQVNPE HKKKKKIKLT LPAAAAPPTD  240
NNTTQNPSVR KCMHCEITKT PQWRAGPMGP KTLCNACGVR YKSGRLFPEY RPAASPTFIP  300
SVHSNSHKKV LEMRTKCGTA DAPEMIPNKS NPALDYI*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1160164KRPRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012455387.10.0PREDICTED: GATA transcription factor 8-like
TrEMBLA0A0D2UXE70.0A0A0D2UXE7_G
STRINGPOPTR_0010s23010.11e-145(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54810.22e-40GATA family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]