PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.011G209200.2
Common NameB456_011G209200, LOC105777759
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 362aa    MW: 39228.7 Da    PI: 5.6673
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.011G209200.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.59.2e-11162214557
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                         kr++r + NR +A rs +RK  +i eLe+kv++L++e ++L  +l   +    
  Gorai.011G209200.2 162 KRAKRIIANRQSAARSKERKARYISELERKVQTLQTEATTLSAQLTLFQRDTT 214
                         9****************************************999877666555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.3E-17158222IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.622160223IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.03E-11162213No hitNo description
Gene3DG3DSA:1.20.5.1703.4E-11162216No hitNo description
PfamPF001702.7E-9162211IPR004827Basic-leucine zipper domain
CDDcd147031.34E-24163212No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MQDPPSLKPN PDPPVPSNAS STTPSFPNPT TFRGSYHRRA QSEVQFRIPD DLDLVSDPFE  60
GMGSEDDLFC SYMDIEKLGG SSKGAEEGGG ATGSSTVGSA HNPKGDEISG GSAGMGEKTN  120
EGGKGRHRYS NSVDGCSLME SIEAKKAMAP DKLAELWTID PKRAKRIIAN RQSAARSKER  180
KARYISELER KVQTLQTEAT TLSAQLTLFQ RDTTGLTTEN TELKLRLQAM EQQAQLRDAL  240
NEALKKEVER LKMATGEMST PTDNFNLGMH HIPFTQSSFF PPQPQQVETQ NMQMPPFHPL  300
QSNMLASNQS MVAASGPHAF ADMMQQDPLG RLQGLDISSR DSHLVKSEGP SISAGESSGT  360
L*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00303DAPTransfer from AT2G40620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012456653.10.0PREDICTED: transcription factor RF2b-like
SwissprotQ6S4P41e-103RF2B_ORYSJ; Transcription factor RF2b
TrEMBLA0A0D2VPV10.0A0A0D2VPV1_G
STRINGVIT_13s0067g02900.t011e-151(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40422757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.11e-115bZIP family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]