PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.011G177600.1
Common NameB456_011G177600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family M-type_MADS
Protein Properties Length: 358aa    MW: 39072.1 Da    PI: 9.7051
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.011G177600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF47.71.9e-151152344
                        --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
              SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                        i n++ r v++ kRr g+ KK  EL +LC++e++++i+s++ 
  Gorai.011G177600.1 11 IANNTSRRVSLKKRRLGLVKKVMELTTLCGIEACLVIYSPDE 52
                        899************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006617.142149IPR002100Transcription factor, MADS-box
SMARTSM004322.3E-21160IPR002100Transcription factor, MADS-box
CDDcd002668.32E-31285No hitNo description
SuperFamilySSF554558.11E-23293IPR002100Transcription factor, MADS-box
PRINTSPR004045.0E-8323IPR002100Transcription factor, MADS-box
PfamPF003199.8E-151152IPR002100Transcription factor, MADS-box
PRINTSPR004045.0E-82338IPR002100Transcription factor, MADS-box
PRINTSPR004045.0E-83859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MTRKKVKLAW IANNTSRRVS LKKRRLGLVK KVMELTTLCG IEACLVIYSP DEQEPVVWPS  60
QEEARRLIKK FYQVPEIERI KKMMNLETYI KEKVFMLQDQ LKKMNRKNMK VEVRQLMLQI  120
EQGKMVDEFN VNELDCLIWY METMRIATRK HTEYYQPVPF SSAASIQGVD PLPPPAQGPK  180
IGDQIGNANA MIRSGASSKI SRFQVEGIPG LPYSSAGDSS LAPHLWVLEP SYGASSSVVA  240
EQGMPRPPFG VGSSSNVVAN GLGLPRPPFG KGNSSNVAAY GLGLPSPLAG EGSVVDHLGL  300
PMPSFGEGSS LNVASDHLGL PRLPFGEGRS SNIVVDHLGL PGPPFGEGSS SNTTIWR*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKVKLAWIANNTSRRVSLKKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012453454.10.0PREDICTED: agamous-like MADS-box protein AGL92
TrEMBLA0A0D2UUJ20.0A0A0D2UUJ2_GOSRA; Uncharacterized protein
STRINGGorai.011G177600.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40210.14e-25AGAMOUS-like 48
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]