PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.011G140400.1
Common NameB456_011G140400, LOC105777698
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 399aa    MW: 43657.4 Da    PI: 6.8821
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.011G140400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1301.2e-09209265561
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                         kr++r   NR +A rs +RK  +i+eLe+kv++L++e ++L  +l   +     l++
  Gorai.011G140400.1 209 KRAKRVWANRQSAARSKERKMRYIAELERKVQTLQTEATSLSAQLTLVQRDTNGLTA 265
                         9****************************************9999877766666655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.3E-14205269IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.657207270IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.32E-10209260No hitNo description
Gene3DG3DSA:1.20.5.1703.3E-8209263No hitNo description
PfamPF001702.1E-8209257IPR004827Basic-leucine zipper domain
CDDcd147031.13E-22210259No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 399 aa     Download sequence    Send to blast
MEKDKSPGLL PTSGRFSGFS SSGIAPNNFN PKTETGTFGQ TSENNHFSHD IRKMPDNPPK  60
KLGHRRAHSE ILTLPDDISF DSDTGIVGAA DGPSYSDEAE EDLFSMYLDM DKFNSSSATS  120
TCQVGESSEA AAPVAVPAKS GLSSGENISN GIASSMKPRV RHQHSQSMDG STSIKPEMLM  180
SGSEEVSPAD SKKSMSAANL AELALIDPKR AKRVWANRQS AARSKERKMR YIAELERKVQ  240
TLQTEATSLS AQLTLVQRDT NGLTAENSEL KLRLQAMEQQ VHLQDALNDA MKEEIQHLKM  300
LTVQPMPNGG GMMNFASFGA SQQYYPNNHA KHTLLAAQQF QQLQLHSQKH QHQHQHQFAP  360
NQLHHQQEQT GEMRARGSMP SPNQKDSSSD VNSTASKD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012456530.10.0PREDICTED: probable transcription factor PosF21
SwissprotQ040881e-150POF21_ARATH; Probable transcription factor PosF21
TrEMBLA0A0D2T7V00.0A0A0D2T7V0_G
STRINGVIT_05s0102g01120.t011e-173(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24452772
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.11e-151bZIP family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]