PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.011G090000.2
Common NameB456_011G090000, LOC105778153
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 420aa    MW: 47739.3 Da    PI: 7.359
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.011G090000.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1609.2e-50461712128
                 NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                         +pGfrFhPt+eelv +yL++kvegk++++ e i+ +d+y+++Pw+Lp+ ++ +ekew+f+++rd+ky++g+r+nr+t+sgyWkatg d+ +
  Gorai.011G090000.2  46 MPGFRFHPTEEELVEFYLRRKVEGKRFNV-ELITFLDLYRYDPWELPALAAIGEKEWFFYVPRDRKYRNGDRPNRVTTSGYWKATGADRMI 135
                         79***************************.89***************8778899************************************* PP

                 NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                           ++++ +glkktLvfy+g+apkg +t+W+m+eyrl
  Gorai.011G090000.2 136 RGENSRSIGLKKTLVFYSGKAPKGIRTSWIMNEYRL 171
                         **********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.54E-5645192IPR003441NAC domain
PROSITE profilePS5100555.5745192IPR003441NAC domain
PfamPF023656.6E-2547171IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 420 aa     Download sequence    Send to blast
MAIPPAAIMS NDPNDNTNIN VVDDRNNNNM SSSSNSKDEH EHDMVMPGFR FHPTEEELVE  60
FYLRRKVEGK RFNVELITFL DLYRYDPWEL PALAAIGEKE WFFYVPRDRK YRNGDRPNRV  120
TTSGYWKATG ADRMIRGENS RSIGLKKTLV FYSGKAPKGI RTSWIMNEYR LPHHETERYQ  180
KAEISLCRVY KRPGVEDHPS LPRCLPTRRS AESSRGQQSE KKYPQEAAQQ AMERFQAFGG  240
GQPQQMEIEK LTETDGSSST STSDVTTALG LSKQNLYRPM PPISTTLGLP SGMEGEGMFL  300
NQSKQGCCSL LPNSTTLFPV GSSSVPSNVV DDLHRLVSYQ QVALNQQQYY NTNHPHPHQQ  360
QHQPQSEFST LPPQSQAQPQ QLSLNVLPSA IPSPTAFSDR LWEWNPIPEP NREYNNPFK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-544719219165NO APICAL MERISTEM PROTEIN
1ut4_B6e-544719219165NO APICAL MERISTEM PROTEIN
1ut7_A6e-544719219165NO APICAL MERISTEM PROTEIN
1ut7_B6e-544719219165NO APICAL MERISTEM PROTEIN
3swm_A9e-544719222168NAC domain-containing protein 19
3swm_B9e-544719222168NAC domain-containing protein 19
3swm_C9e-544719222168NAC domain-containing protein 19
3swm_D9e-544719222168NAC domain-containing protein 19
3swp_A9e-544719222168NAC domain-containing protein 19
3swp_B9e-544719222168NAC domain-containing protein 19
3swp_C9e-544719222168NAC domain-containing protein 19
3swp_D9e-544719222168NAC domain-containing protein 19
4dul_A6e-544719219165NAC domain-containing protein 19
4dul_B6e-544719219165NAC domain-containing protein 19
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in aerial organs in early stages of seedling development. {ECO:0000269|PubMed:17653269}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that acts as a floral repressor. Controls flowering time by negatively regulating CONSTANS (CO) expression in a GIGANTEA (GI)-independent manner. Regulates the plant cold response by positive regulation of the cold response genes COR15A and KIN1. May coordinate cold response and flowering time. {ECO:0000269|PubMed:17653269}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00257DAPTransfer from AT2G02450Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian regulation with a peak of expression at dawn under continuous light conditions (PubMed:17653269). Circadian regulation with a peak of expression around dusk and lowest expression around dawn under continuous light conditions (at protein level) (PubMed:17653269). {ECO:0000269|PubMed:17653269}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC8471950.0KC847195.1 Gossypium hirsutum NAC domain protein NAC18 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001314036.10.0NAC domain-containing protein 72-like
RefseqXP_012457236.10.0PREDICTED: NAC domain-containing protein 72
SwissprotQ9ZVP81e-123NAC35_ARATH; NAC domain-containing protein 35
TrEMBLA0A0D2RJ650.0A0A0D2RJ65_GOSRA; Uncharacterized protein
TrEMBLW6JAN00.0W6JAN0_GOSHI; NAC domain protein NAC18
STRINGGorai.011G090000.10.0(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.21e-119NAC domain containing protein 35
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Okajima K
    Molecular mechanism of phototropin light signaling.
    J. Plant Res., 2016. 129(2): p. 149-57
    [PMID:26815763]
  4. Nakasone Y,Ohshima M,Okajima K,Tokutomi S,Terazima M
    Photoreaction Dynamics of LOV1 and LOV2 of Phototropin from Chlamydomonas reinhardtii.
    J Phys Chem B, 2018. 122(6): p. 1801-1815
    [PMID:29355019]