PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.011G057600.5
Common NameB456_011G057600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NF-YA
Protein Properties Length: 239aa    MW: 26559.2 Da    PI: 8.3133
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.011G057600.5genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA50.95e-16184219137
           CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkp 37 
                         dep+YVNaKQyq+Il+RRq Rakle+++kl +k rk 
  Gorai.011G057600.5 184 DEPIYVNAKQYQAILRRRQYRAKLEAQNKL-IKVRKV 219
                         79****************************.998885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.8E-7182234IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115216.857183238IPR001289Nuclear transcription factor Y subunit A
PfamPF020453.9E-11185218IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860188208IPR018362CCAAT-binding factor, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MENKKNSAVS SHSMSTYVVG CSSWENSTES HVQHSSISEN LSLKMGLLPQ YLNNNKQLSF  60
QFQDQDSSST QSTCQSYPEV ASAGDSNLYE QSLISASSGG NEMHGKLVGD HTKLAAPMGT  120
LECVLPPSQV DYSKSNAHIP LHYADPYFGG VVASAYTPQA MIHHQLTMAM LPARVPLPLE  180
LTQDEPIYVN AKQYQAILRR RQYRAKLEAQ NKLIKVRKVC FFKFFLLAAR ELQLRLGW*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012454937.11e-160PREDICTED: nuclear transcription factor Y subunit A-3-like isoform X1
TrEMBLA0A0D2VIQ11e-178A0A0D2VIQ1_GOSRA; Uncharacterized protein
STRINGGorai.011G057600.11e-149(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.23e-41nuclear factor Y, subunit A3
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]