PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.011G057600.2
Common NameB456_011G057600, LOC105776668
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NF-YA
Protein Properties Length: 333aa    MW: 36535.8 Da    PI: 7.9406
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.011G057600.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA103.32.3e-32184240158
           CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                         dep+YVNaKQyq+Il+RRq Rakle+++kl +k rkpylheSRh hAl+R+Rg+gGrF
  Gorai.011G057600.2 184 DEPIYVNAKQYQAILRRRQYRAKLEAQNKL-IKVRKPYLHESRHLHALKRARGNGGRF 240
                         79****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005216.8E-37182243IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.096183243IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.4E-26185240IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006167.1E-23186208IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860188208IPR018362CCAAT-binding factor, conserved site
PRINTSPR006167.1E-23217240IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MENKKNSAVS SHSMSTYVVG CSSWENSTES HVQHSSISEN LSLKMGLLPQ YLNNNKQLSF  60
QFQDQDSSST QSTCQSYPEV ASAGDSNLYE QSLISASSGG NEMHGKLVGD HTKLAAPMGT  120
LECVLPPSQV DYSKSNAHIP LHYADPYFGG VVASAYTPQA MIHHQLTMAM LPARVPLPLE  180
LTQDEPIYVN AKQYQAILRR RQYRAKLEAQ NKLIKVRKPY LHESRHLHAL KRARGNGGRF  240
LNTKKLQESK GITTSNGLDT CFSKSEVHQL ENYKDAASTA SCSDVTTASN SDEIFQQPDF  300
RFSTYSSHIG GPMPGHTGDM QGGGNLHHRL CG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A2e-19184245263NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012454937.10.0PREDICTED: nuclear transcription factor Y subunit A-3-like isoform X1
TrEMBLA0A0D2T3160.0A0A0D2T316_GOSRA; Uncharacterized protein
STRINGGorai.011G057600.10.0(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.14e-78nuclear factor Y, subunit A3
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]