PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.011G046000.2
Common NameB456_011G046000, LOC105776693
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family TCP
Protein Properties Length: 464aa    MW: 50079.8 Da    PI: 7.5515
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.011G046000.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP121.21.2e-37832402136
                 TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgt.......................ssss 69 
                          g+kdrhsk+ T++g+RdRRvRls+++a++f+dLqd+LG+d++sk++eWL+++a  ai el+++                       +++s
  Gorai.011G046000.2  83 SGGKDRHSKVWTSKGLRDRRVRLSVTTAIQFYDLQDRLGYDQPSKAVEWLIKAASDAIAELPSLntsfpdtpkqlsdekrgsggieqGFDS 173
                         689*************************************************************777776666666666666655555555 PP

                 TCP  70 aseceaesssssasnsssgkaaksaakskksqksaasalnlakesrakarararertrekmriknkl 136
                         a+   +++ s+ +++ s +k+a+s++++ ++++s +  ++  +  r kar+rarert++++   +++
  Gorai.011G046000.2 174 AEVELDGDPSNYQQHLSLSKSASSSTSETRKNSSLSLSRSGTRVNRVKARERARERTAKEKEGHQQQ 240
                         5333666666666666666777777777777777776777777999*********888776655444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.0E-4284235IPR005333Transcription factor, TCP
PROSITE profilePS5136931.10585143IPR017887Transcription factor TCP subgroup
PROSITE profilePS513709.946216234IPR017888CYC/TB1, R domain
Sequence ? help Back to Top
Protein Sequence    Length: 464 aa     Download sequence    Send to blast
MEVDEIQTQT CKFSTVGNGR NETSKIGQKG SDSNFPDDEE DGELIKRAAA TAVANGGVAD  60
TIGTNSLRGW HNSSRIIRVS RASGGKDRHS KVWTSKGLRD RRVRLSVTTA IQFYDLQDRL  120
GYDQPSKAVE WLIKAASDAI AELPSLNTSF PDTPKQLSDE KRGSGGIEQG FDSAEVELDG  180
DPSNYQQHLS LSKSASSSTS ETRKNSSLSL SRSGTRVNRV KARERARERT AKEKEGHQQQ  240
NVSPISQNSS FTELLTSGIG NVSNNNTSPS ASASASAHQD PSAESDFYQK ANSTARLWPV  300
TPMDYFASGL LGPSSSRGHH SSGFPGGQIH LVNSLQQPMT TPPFTVSGEN HQEMQHFSFV  360
PNPDHLIPVA TTQPGQGVDY NLNFTISSGL AGFNRGTLQS NSPFLPPHLQ RFSSIDGSSP  420
LYIGTPPVEN HHHHQFTAGL DGRLQLCYGD GNRSSDQKGK GKN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A2e-2390144155Putative transcription factor PCF6
5zkt_B2e-2390144155Putative transcription factor PCF6
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gra.20750.0flower|seedling| flowering
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: During flower development, first observed throughout the floral meristem. Later expressed in rapidly growing floral primordia. Detected to a lower extent in vegetative primordia. During flower development, first observed throughout the floral meristem. Expressed during ovule development (PubMed:25378179). {ECO:0000269|PubMed:10363373, ECO:0000269|PubMed:25378179}.
UniprotTISSUE SPECIFICITY: Expressed in cotyledons, particularly in the vascular region, in leaves, roots, buds, flowers and immature siliques. {ECO:0000269|PubMed:17307931}.
Functional Description ? help Back to Top
Source Description
UniProtPlays a pivotal role in the control of morphogenesis of shoot organs by negatively regulating the expression of boundary-specific genes such as CUC genes, probably through the induction of miRNA (e.g. miR164). Participates in ovule develpment (PubMed:25378179). Participates in ovule develpment (PubMed:25378179). Promotes light-regulated transcription of CHS, CAB, HYH and HY5. Regulates positively photomorphogenesis (e.g. hypocotyl elongation inhibition and cotyledon opening in response to blue light) (PubMed:26596765). {ECO:0000269|PubMed:12931144, ECO:0000269|PubMed:17307931, ECO:0000269|PubMed:25378179, ECO:0000269|PubMed:26596765}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the miRNA miR-JAW (PubMed:12931144). Induced by blue light. Stabilized by light but labile in darkness due to proteasome-dependent proteolysis (at protein level) (PubMed:26596765). {ECO:0000269|PubMed:12931144, ECO:0000269|PubMed:26596765}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012454993.10.0PREDICTED: transcription factor TCP2-like
RefseqXP_012454994.10.0PREDICTED: transcription factor TCP2-like
RefseqXP_012454995.10.0PREDICTED: transcription factor TCP2-like
RefseqXP_012454996.10.0PREDICTED: transcription factor TCP2-like
SwissprotQ93V435e-76TCP2_ARATH; Transcription factor TCP2
TrEMBLA0A0D2UNY10.0A0A0D2UNY1_GOSRA; Uncharacterized protein
STRINGGorai.011G046000.10.0(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18390.22e-42TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 2
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  2. Koyama T,Sato F,Ohme-Takagi M
    Roles of miR319 and TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2017. 175(2): p. 874-885
    [PMID:28842549]
  3. Bresso EG,Chorostecki U,Rodriguez RE,Palatnik JF,Schommer C
    Spatial Control of Gene Expression by miR319-Regulated TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2018. 176(2): p. 1694-1708
    [PMID:29133375]