Plant Transcription Factor Database
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.011G036300.1
Common NameB456_011G036300, LOC105777900
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family BES1
Protein Properties Length: 320aa    MW: 34237.2 Da    PI: 8.8613
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.011G036300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
              DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspe 91 
                         ++++r+ptwkErEnnkrRERrRRaiaaki+aGLR++Gnyklpk++DnneVlkALc+eAGw+ve+DGttyrkg+kp ++++++g sasasp+
                         5899*************************************************************************************** PP

              DUF822  92 sslqsslkssalaspvesysaspksssfpspssl 125
                         ss++ s+ ss+++sp++s  +  ++ +  ++s +
                         ****888888888888777666666555555444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056878.5E-603133IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012456862.10.0PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1
RefseqXP_012456863.10.0PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2
SwissprotQ9ZV881e-131BEH4_ARATH; BES1/BZR1 homolog protein 4
STRINGPOPTR_0004s06100.11e-156(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78700.11e-106BES1/BZR1 homolog 4
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7