PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.010G251100.1
Common NameB456_010G251100, LOC105773324
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 202aa    MW: 23406.4 Da    PI: 4.8057
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.010G251100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM88.89.6e-28161392128
                 NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykv...ePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                         ppG+rF+Ptd el+++yL kkv+g++l+  ++i+e++iy     ePw++   +++++k  y F+k +kk ++gk+  r++  g+Wk + + 
  Gorai.010G251100.1  16 PPGYRFEPTDIELLQDYLLKKVNGEPLPY-NIISECEIYGNqgkEPWKIF--IETSTKTFYVFTKLKKK-SKGKNIDRVAGCGTWKGQRT- 101
                         9****************************.89******9754459****6..66677788888888776.689*************9876. PP

                 NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          +++  ++ ++g +k +vf  + +++g+k +W+mhe++l
  Gorai.010G251100.1 102 DPIMY-EEMKIGNRKLFVFQVKGSNEGVKGHWIMHEFSL 139
                         67777.7899**********9999*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.54E-325158IPR003441NAC domain
PROSITE profilePS5100530.92115158IPR003441NAC domain
PfamPF023654.0E-1816139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MEFDTYDYEF LMTGIPPGYR FEPTDIELLQ DYLLKKVNGE PLPYNIISEC EIYGNQGKEP  60
WKIFIETSTK TFYVFTKLKK KSKGKNIDRV AGCGTWKGQR TDPIMYEEMK IGNRKLFVFQ  120
VKGSNEGVKG HWIMHEFSLV DEEDKQIGDY VLCSIRNKNA KDDTEEEEPP MKKMRYNSED  180
HNSPEPTSSD SPLQTLLSDW S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-221516017167NO APICAL MERISTEM PROTEIN
1ut4_B7e-221516017167NO APICAL MERISTEM PROTEIN
1ut7_A7e-221516017167NO APICAL MERISTEM PROTEIN
1ut7_B7e-221516017167NO APICAL MERISTEM PROTEIN
3swm_A7e-221516020170NAC domain-containing protein 19
3swm_B7e-221516020170NAC domain-containing protein 19
3swm_C7e-221516020170NAC domain-containing protein 19
3swm_D7e-221516020170NAC domain-containing protein 19
3swp_A7e-221516020170NAC domain-containing protein 19
3swp_B7e-221516020170NAC domain-containing protein 19
3swp_C7e-221516020170NAC domain-containing protein 19
3swp_D7e-221516020170NAC domain-containing protein 19
4dul_A7e-221516017167NAC domain-containing protein 19
4dul_B7e-221516017167NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012450554.11e-149PREDICTED: NAC domain-containing protein 55-like
TrEMBLA0A0D2UKM51e-147A0A0D2UKM5_GOSRA; Uncharacterized protein
STRINGGorai.010G251100.11e-148(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13343727
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10490.18e-26NAC domain containing protein 52
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]