PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.010G248600.2
Common NameB456_010G248600, LOC105772592
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family Trihelix
Protein Properties Length: 409aa    MW: 45991.8 Da    PI: 6.3349
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.010G248600.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix80.91.8e-25291375186
            trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                         rW++ ev+aL+ +r+ +e+++  + +k   W+e+s+ m   g++rs+k+Ckekwen+nk+++k   + kk+  e+s++c+yf++l+
  Gorai.010G248600.2 291 RWPDAEVQALVMLRSTLEHKFHITGSKCSIWDEISAGMYNMGYSRSAKKCKEKWENINKYFRKSMGSGKKH-HENSKRCAYFHDLD 375
                         8******************************************************************9998.78888*******97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.922284348IPR017877Myb-like domain
PfamPF138379.3E-18290376No hitNo description
CDDcd122031.70E-23290354No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 409 aa     Download sequence    Send to blast
MELFTGGREA FPQHVTPFPD LTAIMEPAED LMMSDHRPTL PPRKLRPIRY NGRSPASSQA  60
EDHSEFAEAV ELVGDEVCAI NGSSFDYLTP PIKAEVGDVT ATVGGGGSGV EGPPSSEQRG  120
EPSGSSSDSD DDLSATGNEP LKKRKRKSRK KIKLFLEKLV MKVMDKQEQM HKQLMEMIEK  180
REKERLIREE AWKRQEMERV KRDEEARAQE MSRSIALISF IQNALGHEIE IPISTMSCME  240
ENGFKDASED HIQKDTVNPI GPTNRWQEGM MQANGAENHE GGVSCDPNNR RWPDAEVQAL  300
VMLRSTLEHK FHITGSKCSI WDEISAGMYN MGYSRSAKKC KEKWENINKY FRKSMGSGKK  360
HHENSKRCAY FHDLDVLYKN GFGNPVNHIN CIKVDNMDNG ESLKGNEG*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1141146KKRKRK
2141149KKRKRKSRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00552DAPTransfer from AT5G47660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012449413.10.0PREDICTED: trihelix transcription factor GT-2 isoform X2
TrEMBLA0A0D2SYT10.0A0A0D2SYT1_GOSRA; Uncharacterized protein
STRINGGorai.010G248600.10.0(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47660.12e-41Trihelix family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]