PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.010G240700.1
Common NameB456_010G240700, LOC105772789
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family BES1
Protein Properties Length: 323aa    MW: 34628.3 Da    PI: 7.764
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.010G240700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822211.32.4e-6521471150
              DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspe 91 
                         ++++r+ptwkErEnnkrRERrRRaiaaki+aGLR++Gnyklpk++DnneVlkALc eAGw+ve+DGtty+kg+kp +++++ g sasasp+
  Gorai.010G240700.1   2 TSGTRMPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCDEAGWTVEEDGTTYKKGCKPVDRMDILGGSASASPC 92 
                         5899*************************************************************************************** PP

              DUF822  92 sslqsslkssalaspvesysaspksssfpspssldsislasa....asllpvlsvlslvsssl 150
                         ss++        +sp++sy++sp sssfpsp+s+    + +     +sl+p+l++ls+ sss+
  Gorai.010G240700.1  93 SSYH--------PSPCASYNPSPGSSSFPSPASSHYRANGNGnadaNSLIPWLKNLSSGSSSA 147
                         ****........******************9987665444335677**********9977664 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056872.2E-663141IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MTSGTRMPTW KERENNKRRE RRRRAIAAKI FAGLRMYGNY KLPKHCDNNE VLKALCDEAG  60
WTVEEDGTTY KKGCKPVDRM DILGGSASAS PCSSYHPSPC ASYNPSPGSS SFPSPASSHY  120
RANGNGNADA NSLIPWLKNL SSGSSSASSK LAHHLYFAGG SISAPVTPPL SSPTSRTPRT  180
RNDWDETTGG SARTGQRHCY LPSSTPPSPN HQVFPDPEWL SSGPTSPTFS LVSRNPFGFK  240
DEALSAGGSR MWTPGQSGTC SPAFPAGVDQ TSDVPMSDVI AAEFAFGSNF TGLVKPWEGE  300
MIHEECVADD DLELTLGNSK TR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012449695.10.0PREDICTED: BES1/BZR1 homolog protein 4-like
SwissprotQ9ZV881e-131BEH4_ARATH; BES1/BZR1 homolog protein 4
TrEMBLA0A0D2UJY70.0A0A0D2UJY7_G
STRINGPOPTR_0004s06100.11e-149(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19172781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78700.11e-108BES1/BZR1 homolog 4
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]