PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.010G218700.2
Common NameB456_010G218700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 213aa    MW: 23027.6 Da    PI: 7.574
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.010G218700.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_136.97.9e-12163207549
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkel 49 
                         kr++r + NR +A rs +RK  +i eLe+kv++L++e ++L  +l
  Gorai.010G218700.2 163 KRAKRIMANRQSAARSKERKARYITELERKVQTLQTEATTLSAQL 207
                         9***************************************99776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.4E-5159212IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.91161212IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.88E-10163210No hitNo description
Gene3DG3DSA:1.20.5.1701.8E-10163210No hitNo description
PfamPF001702.5E-10163207IPR004827Basic-leucine zipper domain
CDDcd147033.00E-23164212No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MQYPPLLNPN PLPPIPSKPN ASSTTQTALF FPNSTPFCGS HHRRAHSEVQ FRIPDELDLG  60
SDTFEGLGSE DDLFFNYVDI EKLGGSSKGP EEGGGSGSSS GGSGQNQKGE EISGGSGKGE  120
KNDGKGRHRY SNSVDGCSTM ELIEAKKAMP PDKLAELWNI DPKRAKRIMA NRQSAARSKE  180
RKARYITELE RKVQTLQTEA TTLSAQLTLF QA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012449361.11e-155PREDICTED: transcription factor RF2b-like isoform X2
SwissprotQ6S4P45e-53RF2B_ORYSJ; Transcription factor RF2b
TrEMBLA0A0D2UIX81e-157A0A0D2UIX8_G
STRINGVIT_13s0067g02900.t011e-66(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.12e-63bZIP family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]