PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.010G157200.2
Common NameB456_010G157200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family VOZ
Protein Properties Length: 475aa    MW: 52575.2 Da    PI: 5.6583
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.010G157200.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ413.15.2e-1272024161215
                 VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwn 91 
                         p+psaflgpkcalwdc+rpaqg   + d+cssfha+la+neg+pg+ pvlrp+gi+lkdgllfaalsak+qgk+vgipec+gaatakspwn
  Gorai.010G157200.2 202 PSPSAFLGPKCALWDCPRPAQGLGGCLDFCSSFHAALAMNEGPPGMGPVLRPGGIGLKDGLLFAALSAKTQGKDVGIPECQGAATAKSPWN 292
                         89***************************************************************************************** PP

                 VOZ  92 aaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalal 182
                         a+elfdl +l+ge+irewlffdkprrafesgnrkqrslpdy+grgwhesrkqvm+efgglkrsyymdpqp+++fewhlyeyein++da+al
  Gorai.010G157200.2 293 APELFDLLVLDGESIREWLFFDKPRRAFESGNRKQRSLPDYNGRGWHESRKQVMNEFGGLKRSYYMDPQPLNHFEWHLYEYEINKCDACAL 383
                         ******************************************************************************************* PP

                 VOZ 183 yrlelklvdekksakgkvskdsladlqkklgrl 215
                         yrlelklvd+kksakgk  +d+++   k++g+l
  Gorai.010G157200.2 384 YRLELKLVDGKKSAKGKPVNDTVSYPHKHMGKL 416
                         *******************************98 PP

Sequence ? help Back to Top
Protein Sequence    Length: 475 aa     Download sequence    Send to blast
MGKGSKNNCK SASHKLFKDK AKNRVDDLQG MFLDLQFARK ESRGVDVAVL EEQLHQMLRE  60
WKAELNEPSP ASSLQQGGSL GSFSSDICRL LQLCEEEDDA TSILAVPKPE PNDQSLQVGD  120
TAASQEGQHE CGFPLVDQCK ESPSQVCTMS INSLEGATQL EYHQFDLDQD FEHFYTGYNG  180
TEFCREDDAM PRTYSYLPSI CPSPSAFLGP KCALWDCPRP AQGLGGCLDF CSSFHAALAM  240
NEGPPGMGPV LRPGGIGLKD GLLFAALSAK TQGKDVGIPE CQGAATAKSP WNAPELFDLL  300
VLDGESIREW LFFDKPRRAF ESGNRKQRSL PDYNGRGWHE SRKQVMNEFG GLKRSYYMDP  360
QPLNHFEWHL YEYEINKCDA CALYRLELKL VDGKKSAKGK PVNDTVSYPH KHMGKLPDGF  420
PSENKCCVKG RTKVNAKIGV GNFFSTPNAV VPTSEKFEYG PSVQYDYGGS YYLT*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. Expressed in the vascular bundles of various tissues, specifically in the phloem. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012451500.10.0PREDICTED: transcription factor VOZ1
RefseqXP_012451501.10.0PREDICTED: transcription factor VOZ1
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A0D2VAV80.0A0A0D2VAV8_GOSRA; Uncharacterized protein
STRINGGorai.010G157200.10.0(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.20.0vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  4. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  5. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]