PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.010G142400.1
Common NameB456_010G142400, LOC105774550
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 405aa    MW: 45898.3 Da    PI: 7.1299
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.010G142400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM159.11.8e-49371622128
                 NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                         +pGfrFhPt+eelv +yL++kvegk++++ e i+ +d+y+++Pw+Lp++++ +ekew+f+++rd+ky++g+r+nr+t+sgyWkatg d+ +
  Gorai.010G142400.1  37 MPGFRFHPTEEELVEFYLRRKVEGKRFNV-ELITFLDLYRYDPWELPAMAAIGEKEWFFYVPRDRKYRNGDRPNRVTTSGYWKATGADRMI 126
                         79***************************.89***************888889************************************** PP

                 NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                           ++++ +glkktLvfy+g+apkg +++W+m+eyrl
  Gorai.010G142400.1 127 RGENSRSIGLKKTLVFYSGKAPKGIRSSWIMNEYRL 162
                         **********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.06E-5635182IPR003441NAC domain
PROSITE profilePS5100555.40836183IPR003441NAC domain
PfamPF023651.1E-2438162IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 405 aa     Download sequence    Send to blast
MAIASMSNDN TSNVDLDFNN SNSSSSSKDD HEQDTVMPGF RFHPTEEELV EFYLRRKVEG  60
KRFNVELITF LDLYRYDPWE LPAMAAIGEK EWFFYVPRDR KYRNGDRPNR VTTSGYWKAT  120
GADRMIRGEN SRSIGLKKTL VFYSGKAPKG IRSSWIMNEY RLPHHETERY QKAEISLCRV  180
YKRAGVEDHP SLPRCLPTRA LTSSRGVLQS EKKYSQAQDA AQQAMERFQG FGGGQSQPQM  240
EIEKISETDG SSSSTSDVTT ALGLSKQNVY RPTALIRTTL GLPSGIMEEE GLFLNQSKQG  300
CTSLLPNSTT LFQLGSSSVS SNVVDDLHRL VSYQQAAMNP LQYYNTYQQQ QQQPEFSTLP  360
PQSQAQQLSL NVLPNSLPLT TFSDRLWEWS PIPEPSREFT NPFK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-542918310165NO APICAL MERISTEM PROTEIN
1ut4_B2e-542918310165NO APICAL MERISTEM PROTEIN
1ut7_A2e-542918310165NO APICAL MERISTEM PROTEIN
1ut7_B2e-542918310165NO APICAL MERISTEM PROTEIN
3swm_A3e-542918313168NAC domain-containing protein 19
3swm_B3e-542918313168NAC domain-containing protein 19
3swm_C3e-542918313168NAC domain-containing protein 19
3swm_D3e-542918313168NAC domain-containing protein 19
3swp_A3e-542918313168NAC domain-containing protein 19
3swp_B3e-542918313168NAC domain-containing protein 19
3swp_C3e-542918313168NAC domain-containing protein 19
3swp_D3e-542918313168NAC domain-containing protein 19
4dul_A2e-542918310165NAC domain-containing protein 19
4dul_B2e-542918310165NAC domain-containing protein 19
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in aerial organs in early stages of seedling development. {ECO:0000269|PubMed:17653269}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that acts as a floral repressor. Controls flowering time by negatively regulating CONSTANS (CO) expression in a GIGANTEA (GI)-independent manner. Regulates the plant cold response by positive regulation of the cold response genes COR15A and KIN1. May coordinate cold response and flowering time. {ECO:0000269|PubMed:17653269}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian regulation with a peak of expression at dawn under continuous light conditions (PubMed:17653269). Circadian regulation with a peak of expression around dusk and lowest expression around dawn under continuous light conditions (at protein level) (PubMed:17653269). {ECO:0000269|PubMed:17653269}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC8472430.0KC847243.1 Gossypium hirsutum NAC domain protein NAC66 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001313847.10.0NAC domain-containing protein 2-like
RefseqXP_012452539.10.0PREDICTED: NAC domain-containing protein 2-like
SwissprotQ9ZVP81e-118NAC35_ARATH; NAC domain-containing protein 35
TrEMBLA0A0D2VAH20.0A0A0D2VAH2_GOSRA; Uncharacterized protein
TrEMBLW6JF130.0W6JF13_GOSHI; NAC domain protein NAC66
STRINGGorai.010G142400.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM54362750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.11e-114NAC domain containing protein 35
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Okajima K
    Molecular mechanism of phototropin light signaling.
    J. Plant Res., 2016. 129(2): p. 149-57
    [PMID:26815763]
  4. Nakasone Y,Ohshima M,Okajima K,Tokutomi S,Terazima M
    Photoreaction Dynamics of LOV1 and LOV2 of Phototropin from Chlamydomonas reinhardtii.
    J Phys Chem B, 2018. 122(6): p. 1801-1815
    [PMID:29355019]