PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.010G113000.1
Common NameB456_010G113000, LOC105772909
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family WRKY
Protein Properties Length: 497aa    MW: 53812.5 Da    PI: 6.3556
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.010G113000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY79.43.8e-25184240259
                         --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                         +DgynWrKYGqK+vk+ + +rsYY+Ct+++C++kk +e+s++ ++v+e++++g H h+
  Gorai.010G113000.1 184 SDGYNWRKYGQKQVKSPKGSRSYYKCTFSDCQAKK-IECSDDTGHVIEVVNKGMHSHK 240
                         8********************************98.*********************7 PP

2WRKY98.34.9e-31359415359
                         -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                         Dgy+WrKYGqK+vkg+++pr+YYrCtsagCpv+k++e++ +++++++itY+g H+h+
  Gorai.010G113000.1 359 DGYRWRKYGQKMVKGNPNPRNYYRCTSAGCPVRKHIETAVDNTNAIIITYKGVHDHD 415
                         9*******************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.7E-20179242IPR003657WRKY domain
SuperFamilySSF1182908.76E-20181242IPR003657WRKY domain
SMARTSM007741.3E-23183241IPR003657WRKY domain
PROSITE profilePS5081116.386184242IPR003657WRKY domain
PfamPF031065.2E-17185240IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.3E-31342417IPR003657WRKY domain
PROSITE profilePS5081131.904352417IPR003657WRKY domain
SuperFamilySSF1182908.5E-27353417IPR003657WRKY domain
SMARTSM007748.6E-35357416IPR003657WRKY domain
PfamPF031062.6E-23359414IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 497 aa     Download sequence    Send to blast
MAETESQALP TKRHHHHQND DSEGQEDDDE EEEEEDGLEN EEEEEGASRV GESQGAGAAP  60
PSDDAGLKHS QLDTLPNDDP PDGLQVNSTS ESKEGSEFKE KVNIADQEVS PSLAVLSAEA  120
PTSLSQQAPT SVTQGISSAP TPTLQEQSLS VQKVNGASVP KANQQKSYNL KMVSVVPIVK  180
TPVSDGYNWR KYGQKQVKSP KGSRSYYKCT FSDCQAKKIE CSDDTGHVIE VVNKGMHSHK  240
PPRKNNFTRE SKIVSSAARA SHNIQPIRIF NDSDPSTSSK ESVPETTVNP ERKGLFSCGS  300
DGNGDVQVKE ELTSEPETKK RQAFLMKKGN TVCSDSVLKA RKKPRFVVHA AGDVGISGDG  360
YRWRKYGQKM VKGNPNPRNY YRCTSAGCPV RKHIETAVDN TNAIIITYKG VHDHDMPVPK  420
KRHGQPIAPL VAAAAPASMN NLQHKKTEGG QSQVTSTQWS VGTEGELTGE ALDLGGEKAI  480
ESARTLLSIG FEIKPC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A1e-26345417274WRKY transcription factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF6697680.0KF669768.1 Gossypium hirsutum WRKY transcription factor 82 (WRKY82) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012449854.10.0PREDICTED: probable WRKY transcription factor 32 isoform X1
SwissprotP595831e-133WRK32_ARATH; Probable WRKY transcription factor 32
TrEMBLA0A0D2SR030.0A0A0D2SR03_G
STRINGVIT_11s0037g00150.t011e-174(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63382844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.11e-126WRKY DNA-binding protein 32
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]