PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.010G108300.1
Common NameB456_010G108300, LOC105772532
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family CPP
Protein Properties Length: 633aa    MW: 69191.7 Da    PI: 7.9747
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.010G108300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR41.52.7e-13143182242
                 TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
                         ++k+CnCk+s+Clk+YCeCf++g +C+  C+C +C+N+ e+
  Gorai.010G108300.1 143 KQKQCNCKNSRCLKLYCECFSSGFYCNG-CNCLNCHNNVEN 182
                         89**************************.********9875 PP

2TCR50.15.5e-16227266140
                 TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                         k++kgC+Ckks+ClkkYCeCf+a+  Cse+CkC dCkN e
  Gorai.010G108300.1 227 KHNKGCHCKKSSCLKKYCECFQANILCSENCKCMDCKNFE 266
                         589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011145.0E-14142182IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.371143267IPR005172CRC domain
PfamPF036383.0E-10144179IPR005172CRC domain
SMARTSM011143.3E-19227268IPR033467Tesmin/TSO1-like CXC domain
PfamPF036382.3E-12230265IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 633 aa     Download sequence    Send to blast
MIGQGETVSD FTPKKLARQL DFTAGCRASG NATLPDHPMQ LQSQPQPQWQ SQTPLPTKPQ  60
QQPQELQLRL CLQPQTVQSP QSPPVPLVQI RPPPPPSQPV TVMQRVPHPV QKLPPQTYQL  120
SKQESPRSRP RVHADAKDGT PKKQKQCNCK NSRCLKLYCE CFSSGFYCNG CNCLNCHNNV  180
ENEAARQEAV GTTLERNPNA FRPKIASSPH RPQDTRDDAH DVQLVGKHNK GCHCKKSSCL  240
KKYCECFQAN ILCSENCKCM DCKNFEGSEE RRALVHGDHN SMAYMQQANA AISGAVGSSG  300
FGIPVTSKKR KSEEIIFGLA VKDQSVHKIV QQQQQQENHL RDLLATCSPL STPLSGTANK  360
ESLGSSKFTY RSPLANILQP QYVKELCSVL VLVSSEARRA LAAERSGKKD QQAKGGSIET  420
TVSSNQMHEM SQNGNGVLSS ATDDCESENH GDANKSGDCG ANEDSVQNGK PLSPRTRALM  480
CDEEDTMFMA VGSPDLLTDR SQNITQKSLN GHECTEVYAE QESLVLTVFR DFLNQLITRG  540
SIKETRCFPS PLSEKRSEQE PAENGAIKSG NQAVGQKQPY PNGIVKSPNP APAEISQTLS  600
AASSVLNTDL PLKHESPIGK EDRKNVGIEG SN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A3e-2914427611132Protein lin-54 homolog
5fd3_B3e-2914427611132Protein lin-54 homolog
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6225215e-74JX622521.1 Gossypium hirsutum clone NBRI_GE69283 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012449292.10.0PREDICTED: protein tesmin/TSO1-like CXC 6 isoform X2
TrEMBLA0A0D2UC940.0A0A0D2UC94_GOSRA; Uncharacterized protein
STRINGGorai.010G108300.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-127Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]