PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.010G106100.1
Common NameB456_010G106100, LOC105771491
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family GATA
Protein Properties Length: 338aa    MW: 37287.5 Da    PI: 6.5654
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.010G106100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.29.4e-18233267135
                GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                         C +C t kTp+WR gp g+ktLCnaCG++y++ +l
  Gorai.010G106100.1 233 CLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRL 267
                         99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169925.4E-781320IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011412.242227263IPR000679Zinc finger, GATA-type
SMARTSM004013.7E-17227277IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.85E-15229291No hitNo description
Gene3DG3DSA:3.30.50.103.0E-14231265IPR013088Zinc finger, NHR/GATA-type
CDDcd002026.00E-14232279No hitNo description
PROSITE patternPS003440233258IPR000679Zinc finger, GATA-type
PfamPF003201.2E-15233267IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MEFIQESSYC GGDHFIVEDL LDFSNDDAVF TDGTFDSSLA LAHSTDSSTF TPVDSCTSSL  60
FSVCEPNIGT DIGCRGLNHD QFAGDLPPPY DDLAELEWLS NFVEESFSCE HLQKLHLISG  120
LKTRPDKSSE TRETQAVDGD SDHSNSNGNP IFDPDMAVPA KARRKRSRAA PCNWAFRLLA  180
LSLTSSSSEP GTDVAVPVQP PLTNQTGKKP AKKTSSKKKD GGEVATNPDG RKCLHCATDK  240
TPQWRTGPMG PKTLCNACGV RYKSGRLVPE YRPAASPTFV LTKHSNSHRK VLELRRQKEM  300
VRAQQQHRHH QNMVYDASNG DDYLIHQYVS PDFRQLI*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1207218KKPAKKTSSKKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ5244652e-60HQ524465.1 Gossypium herbaceum clone NBRI_G035 simple sequence repeat marker, genomic sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012448404.10.0PREDICTED: GATA transcription factor 12-like
SwissprotP697812e-90GAT12_ARATH; GATA transcription factor 12
TrEMBLA0A0D2UC740.0A0A0D2UC74_G
STRINGPOPTR_0006s25410.11e-134(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM66252644
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25830.11e-79GATA transcription factor 12
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]