PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.010G086300.6
Common NameB456_010G086300, LOC105773066
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NF-YA
Protein Properties Length: 338aa    MW: 36922.4 Da    PI: 9.4958
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.010G086300.6genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA99.82.8e-31187243158
           CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                         d p+YVNaKQy++Il+RR  Rakle+++kl  ksrkpylheSRh hA++R RgsgGrF
  Gorai.010G086300.6 187 DGPVYVNAKQYHGILRRRRYRAKLEAQNKL-VKSRKPYLHESRHLHAVNRVRGSGGRF 243
                         57****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.6E-34185246IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.004186246IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006168.0E-23189211IPR001289Nuclear transcription factor Y subunit A
PfamPF020459.6E-27189243IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860191211IPR018362CCAAT-binding factor, conserved site
PRINTSPR006168.0E-23220243IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MSYMAVRVQS LSKKNFDERF SILSLPHMSV GFQPWWNSNE QKIAHSLPQN ISLKVETPSK  60
LHHNAKHLDH QLPDQESTSA QAICQSRPEM GVTRGSNPSF YSSDFGQDES CGKDIEGQMK  120
PINNPNTVFS PSNPNYNLSM ASAQYPYADV CIGGLFTPYG QPAIIQAQMA GGSAPARLPL  180
PLDLAEDGPV YVNAKQYHGI LRRRRYRAKL EAQNKLVKSR KPYLHESRHL HAVNRVRGSG  240
GRFLSKKKLQ QPHHPTSNPS SRSISDASCL DRKNSGSELE SHLHGGGCSS SSTSCSDISS  300
ASNNNGSFQL RKHGFMDISP GVSSMCNGLQ NCASVGL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A9e-21187253268NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012450139.10.0PREDICTED: nuclear transcription factor Y subunit A-3-like isoform X1
RefseqXP_012450140.10.0PREDICTED: nuclear transcription factor Y subunit A-3-like isoform X1
RefseqXP_012450141.10.0PREDICTED: nuclear transcription factor Y subunit A-3-like isoform X1
RefseqXP_012450142.10.0PREDICTED: nuclear transcription factor Y subunit A-3-like isoform X1
TrEMBLA0A0D2UB750.0A0A0D2UB75_GOSRA; Uncharacterized protein
STRINGGorai.010G086300.11e-159(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2440034
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30500.24e-35nuclear factor Y, subunit A7
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]